KEGG   Clostridium botulinum A Hall: CLC_3254Help
Entry
CLC_3254          CDS       T00575                                 

Gene name
pyc
Definition
(RefSeq) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00020  Citrate cycle (TCA cycle)
cbh00620  Pyruvate metabolism
cbh01100  Metabolic pathways
cbh01120  Microbial metabolism in diverse environments
cbh01200  Carbon metabolism
cbh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CLC_3254 (pyc)
   00620 Pyruvate metabolism
    CLC_3254 (pyc)
Enzymes [BR:cbh01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     CLC_3254 (pyc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N HMGL-like Biotin_carb_C Biotin_lipoyl Dala_Dala_lig_C Biotin_lipoyl_2 ATP-grasp ATP-grasp_3 ATP-grasp_4 HlyD_D23 RnfC_N ATPgrasp_ST GARS_A GCV_H
Motif
Other DBs
NCBI-GeneID: 5401462
NCBI-ProteinID: YP_001389036
Position
complement(3400982..3404416)
Genome map
AA seq 1144 aa AA seqDB search
MNKFKRVLVANRGEIAIRVFRACHELGIRTVAIYSEEDKFSLFRTKADEAYLIGKNKGPI
DAYLNIEEIIQLALKKGVDAIHPGYGFLAENSEFARKCREAGIEFIGPTAEMMEKLGDKI
KSKIVAEKAGVPTIPGVQKPIKSEKEALEFARYCGYPIMLKAAAGGGGRGMRIVRTEEEL
ISSFKSAKNEAKKAFGIDDIFIEKYLENPKHIEVQILGDKHGNIVHLYERDCSIQRRHQK
VIEFTPAFALPKKKREEICNDALKIAKTVGYKSAGTLEFLVDTTGNHYFIEMNPRIQVEH
TVTEMITGIDIVQSQILIAEGYKLDSEEVGIKSQESIQTRGYAIQCRVTTEDPSNNFAPD
TGKIEDYRTGSGFGIRLDGGNGFTGSVISPYYDSLLVKTTSWSRTFNDAIRKSIRAIKEF
KIDGVKTNIGFLINVLNHEQFRKGQCDTNFIEKNPELFDITSKTDDEVRILKFIGEKVVN
ETHGIKKDFDVPTIPIVDEGLSLKGTKQILDEKGPEGLVSWIKTQNKLLLTDTTMRDAHQ
SLMATRMRSVDMFKIAKAQSVLGKDLFSMEMWGGATFDVAYRFLKESPWTRLEELRKSIP
NVLFQMLIRGANAVGYKNYPDNVIRKFIKQSADSGIDVFRIFDSLNWLKGMEVATDEVLK
QNKVAETCMCYTGDILEEYRDKYSLQYYVDLAKDIEKTGAHILGIKDMSALLKPYAAVKL
IKALKNEISIPIHLHTHDTTGNGVATVLMAAHAGVDIVDTAFNSMSGLTSQPALNSIVAA
LENTDRETGLDLTDMQKLSDYWSAVRPVYSQFESGLKSGSAEIYKYEIPGGQYSNLKPQV
ESFGLGHKFEEVKEMYKKVNEMLGDIIKVTPSSKVVGDLAIFMVKNDLTPENIYEKAEKM
AFPDSAVSYFKGMMGQPMGGFPEKLQKLVLKGEDPITCRPGEMLPPEDFEKIREHLKEKH
DLDATENDIISYALYPEVFDKYLDFLKEYGDLSHMGSDVFFHGLYEGETAEIELQEGKTF
IVQLSEIGKVDSEGNRAVVFEINGNRREIRIKDKSSLMAQNITSNSTKMADPANKKHIGS
SIPGTVIKVLVNKGDEIKEGDSLIVIEAMKMETNIVASLSGVVGSLLAKEGDQVKSGQLL
LELE
NT seq 3435 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagtttaaaagagtattagtggcaaatagaggtgaaatcgcaataagagtgttt
agagcatgtcatgaattaggcattagaactgttgcgatatattcagaagaagataaattc
tcactatttagaaccaaggcagatgaagcatatcttataggaaaaaataaaggtcctata
gatgcttatttgaatatcgaggaaataatacaattggctttaaaaaaaggggtagatgcg
atacatccaggttatggcttcttggcagagaattctgaatttgcaagaaaatgtagagaa
gcagggatagagtttatagggcctacagcggaaatgatggaaaagctaggagataaaata
aagtctaaaatagttgcagaaaaagcaggggtacctactatacctggagttcaaaaacca
attaaatcagagaaagaagctttagaatttgcaagatactgtggatatccaataatgctc
aaggcagctgctggtggtggcggtagagggatgagaatagttagaacagaagaagaatta
atatcttcctttaaaagtgcaaaaaatgaagctaaaaaggcttttggtatagatgatata
tttatagaaaaatatttagaaaatcctaaacatatagaagttcaaatattaggagataag
catggaaatatagtgcatctatatgaaagggactgttctatacaaagaagacatcaaaag
gttatagaatttacaccagcttttgccctaccaaagaaaaagagagaagaaatatgtaat
gatgctttaaaaatagctaaaactgtagggtataaaagtgcaggtacattagaattttta
gtagatactacaggaaatcactattttatagaaatgaatccaagaatacaggtagaacat
actgttacagaaatgattacaggaattgatattgttcaaagtcaaattttaatagcagag
ggatacaaattagattcagaagaagtaggcataaaatctcaagaatccatacaaacaaga
ggatatgctattcagtgtagggtaactacagaagatccatctaataattttgcaccagat
acagggaaaatagaagattatagaacaggttcaggatttggtattagattagatggtggg
aatggttttacaggttctgttataagcccatattatgatagtttattagttaaaactaca
tcctggtctagaacatttaacgatgctataagaaagtccataagagctataaaagaattt
aaaatagatggtgttaaaactaacataggatttttaataaatgttttaaatcatgaacaa
tttagaaaaggacaatgtgatactaattttatagaaaagaatccagaattatttgatata
acatcaaaaaccgatgatgaagttagaatattaaaattcataggtgaaaaggtagtaaat
gaaacccatggtataaagaaagattttgatgtgcctacaataccaatagtagatgaagga
ttaagtttaaaaggaactaaacaaatattagacgaaaaaggtccagaggggttagtgagt
tggataaaaactcaaaataagcttcttttgacagacacaactatgagagatgctcatcaa
tctcttatggccacaagaatgagaagtgtagatatgtttaaaatagctaaggctcaatca
gtgcttggaaaagatttattttccatggaaatgtggggaggagcaacctttgatgtagct
tatagatttttaaaagaatctccttggactagactggaagagctaagaaaatctataccg
aatgtattgtttcaaatgctaataagaggggctaacgcggttggctataaaaattatcca
gacaatgttataagaaaatttataaagcagtctgcagattcaggtatagatgtatttaga
atatttgattccttaaactggttaaagggaatggaagtagccacagatgaggttttaaaa
caaaataaagtagcagaaacttgtatgtgttatacaggagatatattagaagaatataga
gataaatatagcttgcaatattatgtggatttagcaaaagatatagaaaaaacaggagca
catatacttggaataaaagatatgtcagctttattaaaaccatatgctgcagttaagctt
ataaaggcattaaaaaatgaaatatctatcccaatacatcttcatactcatgatactaca
ggtaatggtgtggctacagtacttatggcagcccatgcaggagttgatattgtagatact
gcgtttaatagtatgtcaggccttacaagtcaaccagccttaaattccatagtagcagca
ttagaaaacacagatagggaaacaggactagatttaacagatatgcagaaattatcagac
tattggagtgctgtaagaccggtatatagtcaattcgagtcaggattaaaatcaggttct
gcagaaatatataaatacgaaatacctggaggacaatattctaatttaaaaccacaggta
gaaagctttggattaggtcataaatttgaagaagtaaaagaaatgtataaaaaagttaat
gaaatgcttggtgatattataaaggttactccatcttcaaaggtggttggagacttggct
atctttatggtaaaaaatgatctaacacctgaaaatatatatgaaaaagctgaaaaaatg
gctttcccagattcagctgtatcatattttaaaggaatgatgggtcaaccaatgggtggt
ttcccagaaaaattgcagaagttagttttaaaaggggaagaccctataacttgtagacca
ggagagatgttgcctccagaagattttgaaaaaataagagaacatttaaaggaaaagcat
gatttagatgcaacagaaaatgatattataagttatgcattatatccagaggtttttgat
aagtatttagactttttaaaggaatacggggatttaagtcatatgggtagtgatgtattc
ttccatggattatatgaaggagaaacagctgaaatagagctacaagaaggaaaaacattt
atagttcaattatctgaaataggaaaagtagattcagaggggaatagagcagtagttttt
gaaataaatgggaatagaagagaaataagaataaaagataaatctagtttaatggcgcaa
aatataacttctaatagcacaaagatggcagatcctgcaaataaaaaacatataggatct
agtataccaggtacagtaataaaagttttagtaaataagggagatgaaataaaagaagga
gatagcttgattgtaatagaagctatgaaaatggaaactaatatagtggctagtttgtca
ggggtagtaggaagtttgttagcaaaagaaggagatcaagttaagtcagggcaactactt
ttagaattagaataa

DBGET integrated database retrieval system