KEGG   Clostridium botulinum A Hall: CLC_3420Help
Entry
CLC_3420          CDS       T00575                                 

Gene name
rplV
Definition
(RefSeq) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CLC_3420 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cbh03011]
    CLC_3420 (rplV)
Ribosome [BR:cbh03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CLC_3420 (rplV)
  Bacteria
    CLC_3420 (rplV)
  Archaea
    CLC_3420 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 5401521
NCBI-ProteinID: YP_001389198
Position
complement(3577111..3577446)
Genome map
AA seq 111 aa AA seqDB search
MEAKAIVRYVRMSPSKIGVVLDLVRGKDVNEAFAILKYTPKDAAEVIYKALKSAVANAEN
NLNLDVNSLYISEAHVGQGPTLKRYQPHAQGRAFRIRKRTSHLTLVVKERV
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagctaaggctatagttagatatgtaagaatgtctccaagcaagattggagttgtt
cttgacttagtaagaggtaaagatgttaatgaagcatttgctatattaaaatatactcca
aaggatgcagcggaagtaatttataaagctttaaaatcagctgttgcaaatgcagaaaac
aatttaaatttagatgttaatagtttatatatatcagaagcacatgtaggtcaaggacca
acattaaaaagatatcaaccacatgctcaaggtagagcgtttagaataagaaagagaaca
agtcatttaactttagttgttaaagaaagagtttaa

DBGET integrated database retrieval system