KEGG   Clostridium botulinum A Hall: CLC_3615Help
Entry
CLC_3615          CDS       T00575                                 

Gene name
purA
Definition
(RefSeq) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
cbh  Clostridium botulinum A Hall
Pathway
cbh00230  Purine metabolism
cbh00250  Alanine, aspartate and glutamate metabolism
cbh01100  Metabolic pathways
Module
cbh_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:cbh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CLC_3615 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CLC_3615 (purA)
Enzymes [BR:cbh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     CLC_3615 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-GeneID: 5400815
NCBI-ProteinID: YP_001389337
UniProt: A5I7Y9
Position
complement(3730839..3732125)
Genome map
AA seq 428 aa AA seqDB search
MSAFIVLGAQWGDEGKGKMTDYLAENADVVVRFQGGNNAGHTVVVGEKEYKLHLIPSGIL
YNDKLNVIGNGVVLDPKALFEEINYLESLGVEITPDRLIISDRAHVIMPYHRILDGIKER
ARGNKDIGTTGKGIGPSYTDKMERSGIRVCDLIHKEVFEENLKETLEVKNKIITEIFGGR
ALDYNEIYNEYLGYAEKLRPFVKDISVIVNKKIKDGKEVLFEGAQGTLLDIDYGTYPYVT
SSSTIAGGVCIGAGVGPTAITNAVGIAKAYTTRVGKGPFPTELLDSTGDWVREKGHEFGV
TTGRARRCGWLDLVILKTSARISGLTSFAVTKIDTLAGLDTLKVCTGYRLNGEIIDYVPA
SLEDLAKCEPIYEEFEGWDDSIANARCYEDLPENAIKYLKKIEDFTETKVSIVSVGPKRD
QTMMISEI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcttttatagtattaggggcccaatggggcgatgaaggtaaaggaaaaatgact
gattatttagctgaaaatgcagatgtagttgtaagatttcaaggtggtaataacgcaggt
catacagtagttgtaggagaaaaggaatataaattacacttaataccttcaggtatactg
tataatgacaaactaaatgtaataggaaatggagtagttttagatccaaaggctttattt
gaagaaataaactatttagaatctttaggagtagaaataacaccagatagattaataata
agtgatagagctcatgtaataatgccatatcataggatattagatggaataaaagaaaga
gctagaggaaataaagatataggaactacaggaaagggtataggaccaagttatacggat
aaaatggaaagaagcggtataagggtttgcgatcttatacataaagaagtttttgaagaa
aatttgaaagaaactttagaagtaaaaaataaaataataacagaaatatttggtggaagg
gctttagactataatgaaatctataatgaatatttaggatatgcagaaaaattaagacct
tttgtaaaagatatatctgttatagttaacaaaaaaataaaagatggtaaagaagtgtta
tttgaaggagctcaaggaacattacttgatatagattatggaacatatccttatgtaaca
tcttcaagcacaatagctggaggagtttgcataggagcaggtgtagggccaacagctata
actaatgcagtaggtatagcaaaagcatatacaacaagagtaggaaaaggtcctttccca
acagagcttttagatagcactggagactgggtaagagaaaagggacatgagtttggagtt
actacagggagagcaagaagatgtggatggttagatttagttatattaaaaacttcagcg
agaatatcaggacttacaagctttgcagtaacaaaaattgatacattagcaggattagat
acattaaaagtatgtacaggatatagactaaatggagaaattatagattatgttcctgct
agcttagaagatttagcaaaatgtgaaccaatatatgaagaatttgaaggttgggatgat
agtatagctaatgctagatgttatgaagatttacctgaaaatgctataaaatatttaaag
aaaatagaagatttcacagaaacaaaggtatctatagtttctgtaggtccaaaaagagat
caaactatgatgatatcagaaatttaa

DBGET integrated database retrieval system