KEGG   Clostridium botulinum Ba4: CLJ_B1021Help
Entry
CLJ_B1021         CDS       T00895                                 

Gene name
dhaD
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
cbi  Clostridium botulinum Ba4
Pathway
cbi00561  Glycerolipid metabolism
cbi00640  Propanoate metabolism
cbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CLJ_B1021 (dhaD)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CLJ_B1021 (dhaD)
Enzymes [BR:cbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     CLJ_B1021 (dhaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase GATase_4
Motif
Other DBs
NCBI-ProteinID: ACQ52679
UniProt: A0A3F2ZRS9
Position
complement(1035177..1036307)
Genome map
AA seq 376 aa AA seqDB search
MRKAFICPTKYVQGEDEILNLGYFVKSFGESALLIAHKDDIERVKDKLDSTAKKFGITFV
ESAFCGECSREEVARLQEIAKNNKCACTIGLGGGKAIDTAKCVAKGNSLIIVPTIAATDA
PTSHSAVLYTPDGAFDDYAYFWQSPTVILIDTTVIANAPTRFLVSGMGDALSTYFEARAT
SNSFSNVNAGLPCGVREGLCAPAKGTNTALTLAKACYKTLLEDGVKAKIASDCNLVTQAL
ENIIETNILLSGLGFESAGLAAAHAIHDGLTILEGTHKYFHGEKVAFGTIAQLVLENAPK
EEIDEVINFCLEIGLPVCLEDIGVDSITDEELMEVAKKSCIEEESIHSMPFKVTPEAVAA
AIITADTLGKKYKSNK
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcatttatttgtccaactaaatatgttcaaggtgaagatgaaatattaaac
ttaggatattttgtaaagagttttggggaatcagctctattaatagctcacaaagatgat
atagaacgtgttaaagataaattagattcaactgctaaaaaatttggaattacttttgta
gaaagtgcattctgtggagaatgttcaagagaagaagttgcaagattacaagaaatcgca
aaaaataataaatgtgcatgcactataggacttggcggtggtaaagctatagatacagca
aaatgcgttgctaagggtaattcattaataattgttccaacaatagcagctacagatgct
ccaactagtcactctgctgtactttacacaccagacggtgcatttgatgattacgcttac
ttctggcaaagtccaactgtaattttaatagatactacagttattgcaaatgctccaaca
agattcttagtttcaggaatgggtgatgcattatcaacatatttcgaagcaagagcaact
tcaaattctttttcaaatgttaatgcaggtttaccttgcggagttagagaaggattatgt
gcaccagcaaaaggaactaacacagcattaacacttgcaaaagcttgttataaaacatta
ttagaagatggtgtaaaagcaaaaatagcatcagattgtaatttagtaacacaagcatta
gaaaacataatagaaacaaatattcttttatcaggactaggttttgaaagtgctggttta
gcagctgctcatgcaatccatgatggattaactatactagaaggaactcacaaatacttc
catggagaaaaagttgcctttggaacaattgcccaattagttcttgaaaatgcaccaaaa
gaagaaattgatgaagtaataaacttctgcctagaaattggacttccagtttgcttagaa
gatattggtgtagacagcattactgatgaagaacttatggaagtagctaaaaaatcttgt
atagaagaagaatcaatacactctatgccatttaaggtaactccagaagcagtagcagca
gcaataataacagcagatactttaggtaaaaaatataaatcaaataaatag

DBGET integrated database retrieval system