KEGG   Clostridium botulinum Ba4: CLJ_B1333
Entry
CLJ_B1333         CDS       T00895                                 

Definition
(GenBank) putative xanthine dehydrogenase, molybdopterin-binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
cbi  Clostridium botulinum Ba4
Pathway
cbi00230  Purine metabolism
cbi01100  Metabolic pathways
cbi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CLJ_B1333
Enzymes [BR:cbi01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     CLJ_B1333
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C DUF334
Other DBs
NCBI-ProteinID: ACQ51678
UniProt: A0A3F2ZRQ0
Position
1362503..1364800
AA seq 765 aa
MEDSYDLIGKSINRVDAVAKVTGRAKYCSDYFEANSLVGVVLRSPYAHAKVKNIDTKEAE
VLDGVEAVLTYKNVPNTKFPTAGHPYSLDPSHRDIEDYVLLTDKARFVGDAVAAVIATDE
LTAKKALKLIKVEYEVLSFVIDQEEAIKEGAPVIHDERPNNIVSDFGITVGDPDEVFKNA
DKIYKGQYETQIVQHCQMETHNAMAKLDEKGRMLIITSTQIPHIVRRIVSKACNLPIGKI
RVIKPYVGGGFGGKQDVIIEPLTAIMSLAVNGRCVRLQLSREEAIVATRTRHAMRVNIKI
ALSKDNKIEGYDIENFVNNGAYASHGHSIAMSAGSKIRPLYDIKAEKYRPKTIYTNLPVA
GAMRAYGIPQMCFVIESMIDDMCNDLNMDPVDFRLNSFIKRGHIDKASGLVVRTFGLPEC
LKRGRKLIDWDRKRELYKNQNGPIRKGVGMACFSYFSGTWPVSLEAAGTRIVMNQDGSVQ
VQVGATEIGQGSDTVFSQMAAETIGIPFDMVTIVSQQDTDITPFDTGSYASRQSFIAGQA
IKKAATEVKRKVLKIASDKCRLDAELLDIVDAKIIEKGLRREIYTLEEIAMEAYYNREKY
APITSDLTVKVKNNAIAYGATFVEVEVDIRTGKIKVLDIYNIHDSGKILNKKLAEGQVHG
GVSMALGFALSEKFIIDEKTGSIINNNLLHYKLPTIMDTPNIKCEFVNTYDPTSSYGQKS
LGENTTISPAPAIRNAVLNATGVAFNKLPMDAQSVFEKFKKVGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggaagattcttatgatttaattggaaaaagcataaatagagtagatgcagtagctaaa
gttacaggtagagctaagtattgctcagattattttgaagctaattcacttgtaggagtg
gttttaagaagtccctatgcccatgcaaaagtaaaaaatatagatactaaagaagctgaa
gttttagatggtgttgaagctgtattaacgtataagaatgtaccaaatacgaaatttcct
acggcagggcatccatattcattagatccaagtcatagagacatagaagattatgtatta
cttacagacaaagcacgttttgtaggagatgcagttgcagcagttattgcaaccgatgaa
cttacagctaaaaaagctttaaaattaataaaagtagaatatgaagttttatcttttgta
atcgaccaagaagaagcaataaaagagggagctcctgttattcatgatgaaagaccaaat
aatatagttagtgattttggtataacagtaggagatccagatgaagtatttaaaaatgca
gataaaatttataaaggccaatatgaaactcaaatagtacaacattgtcaaatggaaact
cacaatgctatggcaaagcttgatgagaaaggtagaatgcttattataacatcaacacaa
ataccacatattgtacgaagaatagtttcaaaagcttgtaatttacctatcgggaaaata
agagtaataaagccttatgttggtggaggttttggaggaaaacaagatgttataatagag
ccacttacagccataatgtctcttgcagttaatggaagatgtgtaaggttacaattaagt
agagaagaggcaattgttgcaactagaacaagacatgcaatgagagtaaatatcaaaata
gctttatcaaaagataataaaatagagggttatgatatagagaactttgtaaataatgga
gcttatgcatctcatggacattcaattgctatgagtgcaggaagtaaaattagacctctt
tatgatataaaggcagagaaatatcgccccaaaactatatatactaatcttccagttgca
ggtgcaatgagagcatatggtataccacaaatgtgttttgttatagaatctatgattgat
gatatgtgtaatgatctaaatatggaccctgtagattttagacttaatagttttataaag
aggggtcatatagataaggcatcaggtcttgtagttagaacctttggattaccagaatgt
ttaaaaagaggtagaaaattaatagattgggacagaaaaagagaattatataaaaatcaa
aatggtcctataagaaaaggggttggaatggcttgttttagctatttttcaggaacttgg
cccgtatcacttgaggcagcaggaacaagaatagtaatgaatcaagatggttcagttcaa
gttcaagtaggagctacagaaataggacagggtagtgatacagtatttagtcaaatggca
gcagaaaccattggaataccatttgatatggtaacaatagtctcccagcaagatacagat
attactccctttgatacgggttcctatgcatcaagacaatcttttatagcaggccaagct
ataaaaaaagcagcaacagaagtaaaaagaaaggttctaaaaattgctagtgataaatgt
agattagatgcagagcttttagatattgtagatgcaaagataatagaaaaaggattaaga
agagaaatttatactttagaagaaattgcgatggaggcatattacaatagagaaaaatat
gcacctataacaagtgatttaactgtaaaggttaaaaataatgctatagcctatggggca
acctttgtagaagtagaagttgatataagaacaggaaaaataaaagttttagatatttat
aacatacatgattcaggaaaaattttaaataaaaagttagcagaaggacaagtacacggt
ggtgttagtatggctttaggatttgccttatcagaaaaattcataatagatgaaaaaaca
ggatctataataaacaataatcttttacattataaacttccaactattatggatactcca
aacataaaatgtgaatttgtaaatacctatgatccaacatctagttatggacaaaaatct
ttaggtgaaaatacaacaatttctccagctccagctatacgtaatgccgtattgaatgca
acaggagtagcatttaataaattgccaatggatgctcaatctgtttttgagaaatttaaa
aaggttggacttatatag

DBGET integrated database retrieval system