KEGG   Clostridium botulinum Ba4: CLJ_B1335
Entry
CLJ_B1335         CDS       T00895                                 

Definition
(GenBank) putative xanthine dehydrogenase, iron-sulfur binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
cbi  Clostridium botulinum Ba4
Pathway
cbi00230  Purine metabolism
cbi01100  Metabolic pathways
cbi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CLJ_B1335
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3 Fer2_4
Other DBs
NCBI-ProteinID: ACQ54120
UniProt: A0A3F2ZTM2
Position
1365730..1366203
AA seq 157 aa
MGLKRKIKLTVNDKKYEIEIDIRESLSEVLRSRLHLTGVKQGCLVGECGACTVLIDGVPT
DSCIYLAAWADGKTIKTIEGVQKNGELSEVQKAFIDEGAVQCGFCTPGLVLTTTALVESE
KDYTDDEIKREISGHLCRCTGYNKIFNATKKAILKRK
NT seq 474 nt   +upstreamnt  +downstreamnt
atgggtttaaaaagaaaaataaaacttacagttaatgataaaaagtatgaaatagaaata
gatattagagaatctttatcagaagtgttaagaagtagattacatttaacaggtgttaaa
caaggatgtcttgtaggagaatgtggagcgtgtactgttttaatagatggtgtcccaaca
gactcatgtatttacttagcggcttgggctgatggtaaaacaataaaaactattgagggg
gtacaaaaaaatggtgagctttcagaggtacaaaaagcctttatagatgaaggtgctgta
caatgtggattctgtacaccaggtttagttttaaccacaacagctttagtagaaagcgaa
aaagactatactgatgatgaaataaaaagagaaatatcaggtcacttatgcagatgtacc
ggatataataaaatatttaatgctaccaaaaaagctattttaaaaaggaaataa

DBGET integrated database retrieval system