KEGG   Clostridium botulinum Ba4: CLJ_B2197Help
Entry
CLJ_B2197         CDS       T00895                                 

Gene name
pfkB_2
Definition
(GenBank) 1-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
cbi  Clostridium botulinum Ba4
Pathway
cbi00010  Glycolysis / Gluconeogenesis
cbi00030  Pentose phosphate pathway
cbi00051  Fructose and mannose metabolism
cbi00052  Galactose metabolism
cbi00680  Methane metabolism
cbi01100  Metabolic pathways
cbi01110  Biosynthesis of secondary metabolites
cbi01120  Microbial metabolism in diverse environments
cbi01130  Biosynthesis of antibiotics
cbi01200  Carbon metabolism
cbi01230  Biosynthesis of amino acids
Module
cbi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLJ_B2197 (pfkB_2)
   00030 Pentose phosphate pathway
    CLJ_B2197 (pfkB_2)
   00051 Fructose and mannose metabolism
    CLJ_B2197 (pfkB_2)
   00052 Galactose metabolism
    CLJ_B2197 (pfkB_2)
  Energy metabolism
   00680 Methane metabolism
    CLJ_B2197 (pfkB_2)
Enzymes [BR:cbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLJ_B2197 (pfkB_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ACQ51990
Position
complement(2184958..2185881)
Genome map
AA seq 307 aa AA seqDB search
MIYTLTTNPAIDMNCSSSSNEAFKVNRTNNLSYSPNGKGVNVSLVLNHYSIESKALGFFG
GFTGKYIVEELNKKNILTEAFWIEENTRINVFINTEDNKEFKYVNKGPFVSRETQKDLLK
YLSSNLKKGDYLIISGSLPQSIQEDYYNEILDICMENNVQVILDISSKKLKELLKYKPLL
IKPNDEEVEAIFGLSLKDEEDIKEALKYIYKLGAKNILLTLGEKGMYFYNGDKIYYCNAP
KIKLLSSACAGDSALAAFLSEWLYEANIEKALKKASATGANVAESSALGTFGKVSEYIKK
IHVKEVV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacattaactactaatccagctattgatatgaactgctcttcgagtagtaat
gaagcttttaaggtaaatagaaccaataatttatcttattcacctaatggaaaaggagta
aacgtatcactagttttaaatcattattctatagagagtaaagctcttggattttttgga
ggatttacaggaaagtatattgtagaggaattaaataagaaaaatatacttacagaagcc
ttttggatagaagaaaatacaaggataaatgtatttataaatacggaagataataaagaa
tttaagtatgtaaacaagggaccttttgtttcaagggaaacccaaaaggatttattaaaa
tacttatcatcaaatttaaaaaaaggtgattatttaataataagtggaagtcttccccaa
agtattcaagaggattactacaatgaaattttagatatatgtatggagaataatgttcaa
gttatattagatataagctctaaaaaattaaaagaattattgaaatataaacctttatta
attaaacctaatgatgaagaagttgaggcaatatttggtctaagtttaaaagatgaagag
gatataaaagaggcattaaaatatatttataagttaggtgctaaaaatatacttctgacc
ttaggggagaaaggaatgtatttttacaatggagacaagatttattattgcaatgcacct
aaaattaaacttttaagctctgcttgtgcaggggactcggccttagcagcatttttaagt
gaatggttatatgaagctaatatagaaaaggcacttaaaaaggcatcagccactggtgca
aatgttgctgaatctagtgcattaggaacttttggtaaagtatcagagtatataaaaaaa
atacatgttaaggaggtagtgtaa

DBGET integrated database retrieval system