KEGG   Clostridium botulinum Ba4: CLJ_B3472Help
Entry
CLJ_B3472         CDS       T00895                                 

Definition
(GenBank) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbi  Clostridium botulinum Ba4
Pathway
cbi00071  Fatty acid degradation
cbi00280  Valine, leucine and isoleucine degradation
cbi00310  Lysine degradation
cbi00362  Benzoate degradation
cbi00380  Tryptophan metabolism
cbi00620  Pyruvate metabolism
cbi00630  Glyoxylate and dicarboxylate metabolism
cbi00640  Propanoate metabolism
cbi00650  Butanoate metabolism
cbi00900  Terpenoid backbone biosynthesis
cbi01100  Metabolic pathways
cbi01110  Biosynthesis of secondary metabolites
cbi01120  Microbial metabolism in diverse environments
cbi01130  Biosynthesis of antibiotics
cbi01200  Carbon metabolism
cbi01212  Fatty acid metabolism
cbi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLJ_B3472
   00630 Glyoxylate and dicarboxylate metabolism
    CLJ_B3472
   00640 Propanoate metabolism
    CLJ_B3472
   00650 Butanoate metabolism
    CLJ_B3472
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CLJ_B3472
   00072 Synthesis and degradation of ketone bodies
    CLJ_B3472
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLJ_B3472
   00310 Lysine degradation
    CLJ_B3472
   00380 Tryptophan metabolism
    CLJ_B3472
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CLJ_B3472
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CLJ_B3472
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CLJ_B3472
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbi04147]
    CLJ_B3472
Enzymes [BR:cbi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CLJ_B3472
Exosome [BR:cbi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLJ_B3472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ACQ51610
Position
complement(3487264..3488442)
Genome map
AA seq 392 aa AA seqDB search
MKNVVIASAVRTPIGKFGGTLKDVSAVELGSIVIKEALKRAKVKPEDVDEVIMGNVLQAG
LGQNTTRQSLVAAGIPVEVPGFTINKVCGSGLRAVSLAAQLIKVGDDDIVVAGGTENMSA
APYILQKARWGQRMGDGKIVDEMIKDGLWEAFNDYHMGITAENIAEQWGITREEQDKFSA
KSQQKAEKAVKEGRFKEEIVPVVIKSRKGEVVFDTDEFPRFGATEESLSKLKPAFKKYGT
VTAGNASGINDGAAALVIMSEEKANELGIKPLAKIVAYGTSGVDPKIMGYGPFYATKKTL
EKANLKIEDMDLIEANEAFAAQSLAVAKDLGFDMDKVNVNGGAIALGHPIGCSGARILTS
LLYEMEKRDSKRGLATLCIGGGMGTAIIVERY
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgttgttattgctagtgctgtaagaacacctataggaaaatttggaggaaca
ttaaaagatgtttcagctgtagaattaggaagtattgttattaaagaagctttaaaaaga
gctaaggtaaaacctgaagatgttgatgaagttataatgggaaatgtactacaagcaggt
cttggtcagaacacaacaagacaatctttagtagctgctggtataccagtagaggtacca
ggcttcacaataaataaagtttgtggttcaggacttagagcagtaagcttagcagctcaa
ttaataaaagtaggagacgatgatatagtagtagcaggtggaacagaaaatatgtctgca
gctccatatattttacaaaaagcaagatggggccaaagaatgggagacggaaaaattgta
gatgagatgataaaagatgggctatgggaagcttttaatgactatcatatggggattaca
gctgaaaatatagcagagcaatggggaataacaagagaagagcaagataaattttcagct
aaatcacaacaaaaagcagagaaagctgtaaaagaaggaagatttaaagaggaaatagta
ccagtagttattaaaagtagaaaaggtgaagtagtatttgatactgatgaattccctaga
tttggcgctactgaagagagcctttctaaattaaaaccagcttttaaaaaatatggaaca
gttacagctggtaatgcttcaggcatcaatgatggagcagctgctttagttatcatgagt
gaagaaaaggcaaatgaattaggaattaaacctttagctaaaatagttgcttatggtaca
agtggagtagatccaaagataatgggatatggacctttttatgcaactaaaaaaacttta
gaaaaagctaatctaaaaatagaagatatggatttaatagaagcaaatgaagcttttgcg
gctcaaagtttagctgtagctaaagatttaggctttgatatggataaagtaaatgtaaat
ggtggagctatagctttaggacatccaattggatgttcaggggctagaattttaactagt
ttactatatgaaatggaaaaaagagattcaaaacgtggcttagctaccttatgtataggt
ggtggaatgggaacagctattattgttgaaagatattaa

DBGET integrated database retrieval system