KEGG   Clostridium botulinum H04402 065: H04402_01356
Entry
H04402_01356      CDS       T02076                                 

Definition
(GenBank) xanthine dehydrogenase, molybdenum binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
cbj  Clostridium botulinum H04402 065
Pathway
cbj00230  Purine metabolism
cbj01100  Metabolic pathways
cbj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    H04402_01356
Enzymes [BR:cbj01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     H04402_01356
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: CBZ03170
Position
1459732..1462029
AA seq 765 aa
MEDSYDLIGKSINRVDAVAKVTGRAKYCSDHFEANSLVGMVLRSPYAHAKVKNIDTKEAE
NLDGVEAVLTYKNVPNTKFPTAGHPYSLDPSHRDIEDYVLLTDKARFVGDAVAAVIATDE
LIAKKALKLIKVEYEVLPFVIDQEEAIKEGAPVIHDERPNNIVSDFGITVGDPDEVFKNA
DKIYKGQYETQIVQHCQMETHNAMAKLDEKGRMLIITSTQIPHIVRRIVSKACNLPIGKI
RVIKPYVGGGFGGKQDVIIEPLTAIMSLAVNGRCVRLQLSREEAIVATRTRHAMRVNIKI
ALSKDNKIEGYDIENFVNNGAYASHGHSIAMSAGSKIRPLYDIKAEKYRPKTIYTNLPVA
GAMRAYGIPQMCFVIESMIDDICNDLNIDPVDFRLNSFIKKGHIDKASDLVVRTFGLPEC
LKRGRKLIDWDGKRELYKNQNGPIRKGVGMACFSYFSGTWPVSLEAAGTRIVMNQDGSVQ
VQVGATEIGQGSDTVFSQMAAETIGIPFDMVTIVSQQDTDITPFDTGSYASRQSFIAGQA
IKKAATEVKRKALKIASDKCGLDAELLDIVDAKVIEKGLKRELYNLEEIAMEAYYNREKY
APITSDLTVKIKNNAIAYGATFVEVEVDIRTGKIKVLDIYNIHDSGKILNKKLAEGQVHG
GVSMALGFALSEKFIIDEKTGSIINNNLLHYKLPTIMDTPNIKCEFVNTYDPTSSYGQKS
LGENTTISPAPAIRNAVLNATGVAFNKLPMDAQSVFEKFKEVGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggaagattcttatgacttaattggaaaaagcataaatagagtagatgcagtagctaaa
gttacaggtagagctaagtattgctcagatcattttgaagctaattcacttgtaggaatg
gttttaagaagtccctatgctcatgcaaaagtaaaaaatatagatactaaagaagctgaa
aacttagatggtgttgaagctgtattaacgtataaaaatgtaccaaatacgaaatttcct
acggcaggacatccatattcattagatccaagtcatagagatatagaagattatgtatta
cttacagacaaagcacgctttgtaggagatgcagttgcagcagttattgcgactgatgaa
cttatagccaaaaaagccttaaaattaataaaagtagaatatgaagttttgccttttgta
atagatcaagaagaagcaataaaagagggagctcctgttattcatgatgaaagaccaaat
aatatagttagtgattttggtataacagtaggagatccagatgaagtatttaaaaatgca
gataaaatttataaaggtcaatatgaaactcaaatagtgcaacattgtcaaatggaaacg
cacaatgctatggcaaagcttgatgagaaaggcagaatgcttattataacatcaacacaa
ataccacatattgtacgaagaatagtttcaaaagcttgtaatttacctattggtaaaata
agagtaataaagccttatgttggtggaggctttggaggaaagcaagatgttataatagaa
ccacttacagctataatgtctcttgcagttaatggaagatgtgtaaggttacaattaagt
agagaagaggcaattgttgcaactagaacaagacatgcaatgagagtaaatatcaaaata
gctttatcaaaagataataaaatagaaggttatgatatagagaactttgtaaataatgga
gcttatgcatcccatggacattcaattgctatgagtgcaggaagtaaaattagacctctt
tatgatataaaggcagaaaaatatcgcccaaaaactatatatactaatcttccagttgca
ggtgcaatgagagcatatggtataccacaaatgtgttttgttatagaatctatgattgat
gatatatgtaatgatctaaatatagaccctgtagattttagacttaatagttttataaag
aaaggtcatatagataaggcatcagatcttgtagttagaacctttggattaccagaatgt
ttaaaaagaggtagaaaactaatagattgggacggaaaaagagaattatataaaaatcaa
aatggtcctataagaaaaggtgttggaatggcctgttttagttatttttcaggaacttgg
ccagtatcacttgaggcagcgggaacaagaatagtaatgaatcaagatggttcagtccaa
gttcaagtaggagctacagaaataggacagggtagtgatacagtatttagtcaaatggca
gcagaaactattggaataccatttgatatggtaacaatagtctcccagcaagatacagat
attactccttttgatacaggatcctatgcatcaagacaatcttttatagcaggccaagct
ataaaaaaagcagcaacagaagtaaaaagaaaagctctaaaaattgccagtgataaatgt
ggattagatgcagagcttttggatattgtagatgcaaaggtgatagaaaaaggattaaag
agagaactttataatttagaagaaattgcgatggaggcatattacaatagagaaaaatat
gcacctataacaagtgatttaaccgtaaagattaaaaataatgctatagcctatggggca
acctttgtagaagtagaagttgatataagaacaggaaaaataaaagttttagatatttat
aacatacatgattcaggaaaaattttaaataaaaagttagcagaaggacaagtacacggt
ggtgttagtatggctttaggatttgccttatcagaaaaatttataatagatgagaaaaca
ggatctataataaacaataatcttttacattataaacttccaactattatggatactcca
aacataaaatgtgaatttgtaaatacctatgatccaacatctagttatggacaaaaatct
ttaggtgaaaatacaacaatctctccagctccagctatacgtaatgccgtattaaatgca
acaggagtagcatttaataaattgccaatggatgctcaatctgtttttgagaaatttaaa
gaggttggacttatatag

DBGET integrated database retrieval system