KEGG   Clostridium botulinum H04402 065: H04402_01358
Entry
H04402_01358      CDS       T02076                                 

Definition
(GenBank) xanthine dehydrogenase iron-sulfur subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
cbj  Clostridium botulinum H04402 065
Pathway
cbj00230  Purine metabolism
cbj01100  Metabolic pathways
cbj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    H04402_01358
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3 Fer2_4
Other DBs
NCBI-ProteinID: CBZ03172
Position
1462959..1463432
AA seq 157 aa
MSLKRKIKFTVNDKKYEVEIDIRESLSEVLRSRLHLTGVKQGCLVGECGACTVLIDGVPT
DSCIYLAAWADGKTIKTIEGVQKNGELSEVQKAFIDEGAVQCGFCTPGLVLTTTALVESE
KKYTDDEIKREISGHLCRCTGYNKIFNATKKAILKRK
NT seq 474 nt   +upstreamnt  +downstreamnt
atgagtttaaaaagaaaaataaaatttacagttaatgataaaaagtatgaagtagaaata
gatattagagaatctttatcagaagtgttaagaagtagattacatttaacaggtgttaaa
caaggatgtcttgtaggagaatgtggagcatgtactgtcttaatagatggtgtcccaaca
gactcatgtatttacttagcggcttgggctgatggtaaaacaataaaaactattgagggg
gtgcaaaaaaatggtgagctttcagaggttcaaaaagcctttatagatgaaggtgctgta
caatgtggattctgtacaccgggtttagttttaactacaacagctttagtagaaagcgaa
aaaaaatatactgatgatgaaataaaaagagaaatatcaggtcatttatgtagatgtact
ggatataataaaatatttaatgctaccaaaaaagctattttaaaaagaaaataa

DBGET integrated database retrieval system