KEGG   Clostridium botulinum H04402 065: H04402_02229Help
Entry
H04402_02229      CDS       T02076                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase, R-alcohol forming,(R)-and (S)-acetoin-specific
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cbj  Clostridium botulinum H04402 065
Pathway
cbj00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cbj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    H04402_02229
Enzymes [BR:cbj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     H04402_02229
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     H04402_02229
    1.1.1.-  
     H04402_02229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ApbA ADH_zinc_N_2 Pyr_redox 2-Hacid_dh_C ADH_N_assoc Shikimate_DH Pyr_redox_3 NAD_binding_7 GP68 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CBZ04037
Position
complement(2382902..2383975)
Genome map
AA seq 357 aa AA seqDB search
MKAALWYEKKDVRVEEIEEPKVVEGSVKIKVKWCGICGSDLHEYLGGPIFIPVGQPHALS
GTTAPVVLGHEFSGEIVELGQGVTKFNIGDRVIVEPIVACGKCSACMEGKYNLCSSLGFH
GLCGSGGGLAEYTVFPEEFVHKIPDEISYEDAALVEPMAVALHSVRIANFNTGDTALVLG
AGPIGLATIECLKAAGARLVVVLQRKSIRQKYAKRAGADVVLDPNEVNIPEEVKKLTDGL
GVDVAFETTGAKIGFDTGIESLKFEGTMVITSIWEKDTSFNPNVLVFTEKKIVGTLAYRH
EFPATMALMKDGRIKTDGYITKKIALDDIVEEGFGALTGPEKKKHVKIIVTPDKSLL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcattatggtatgaaaaaaaagatgtaagagtggaagaaattgaagaacca
aaggtagtagaaggatctgtaaaaattaaagtaaaatggtgtggaatatgtggttccgat
ttacatgaatatttaggaggccctatatttattccagtaggacaacctcatgcgttaagt
ggaacaacagcaccagtagttttaggacacgaattttcaggagaaatagtagaattagga
caaggtgtaacaaaatttaatattggagatagggtaattgttgaacctatagtagcttgt
ggaaaatgttcagcctgtatggaagggaaatataatctttgttcatctttaggttttcat
ggactttgtggaagtggcggtggacttgcagaatatactgtatttccagaggaatttgtt
cataaaattccagatgaaatatcctatgaggatgcggctttagtagaaccaatggcagta
gcacttcattctgtaagaatagctaattttaatacaggagatacagctttagtattaggt
gcaggaccaataggtcttgccacaatagaatgcttaaaagcagctggagcaagactcgta
gtagttttacaaagaaaatctataagacaaaaatatgcaaaaagagcaggggcagatgta
gttttagatcctaatgaagttaatataccagaagaagttaaaaaacttacagatgggtta
ggtgtagatgtagcctttgaaaccacaggagctaagataggatttgatactggtattgaa
agcttaaaatttgaaggtacaatggttataactagtatatgggaaaaggatacaagcttt
aatccgaatgtattagtatttactgaaaagaaaattgtaggaactttagcatatagacat
gaattcccagccactatggcgttaatgaaggatggaagaataaaaacagatggatatatt
acaaagaaaatagctttagatgatatagtagaagaaggatttggggctttaactggaccg
gaaaagaaaaaacatgtaaaaattattgtaactccagataaatcacttttataa

DBGET integrated database retrieval system