KEGG   Clostridium botulinum H04402 065: H04402_03288Help
Entry
H04402_03288      CDS       T02076                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbj  Clostridium botulinum H04402 065
Pathway
cbj00071  Fatty acid degradation
cbj00280  Valine, leucine and isoleucine degradation
cbj00310  Lysine degradation
cbj00362  Benzoate degradation
cbj00380  Tryptophan metabolism
cbj00620  Pyruvate metabolism
cbj00630  Glyoxylate and dicarboxylate metabolism
cbj00640  Propanoate metabolism
cbj00650  Butanoate metabolism
cbj00900  Terpenoid backbone biosynthesis
cbj01100  Metabolic pathways
cbj01110  Biosynthesis of secondary metabolites
cbj01120  Microbial metabolism in diverse environments
cbj01130  Biosynthesis of antibiotics
cbj01200  Carbon metabolism
cbj01212  Fatty acid metabolism
cbj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    H04402_03288
   00630 Glyoxylate and dicarboxylate metabolism
    H04402_03288
   00640 Propanoate metabolism
    H04402_03288
   00650 Butanoate metabolism
    H04402_03288
  09103 Lipid metabolism
   00071 Fatty acid degradation
    H04402_03288
   00072 Synthesis and degradation of ketone bodies
    H04402_03288
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    H04402_03288
   00310 Lysine degradation
    H04402_03288
   00380 Tryptophan metabolism
    H04402_03288
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    H04402_03288
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    H04402_03288
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    H04402_03288
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbj04147]
    H04402_03288
Enzymes [BR:cbj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     H04402_03288
Exosome [BR:cbj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   H04402_03288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CBZ05089
Position
complement(3422200..3423378)
Genome map
AA seq 392 aa AA seqDB search
MKNVVIASAVRTPIGKFGGTLKSVSAIELGSIVIKEALKRANVKPEDVDEVIMGNVLQAG
LGQNSTRQSAVAAGIPVEVPSFTINKVCGSGLRAVSLATQLIKLGDDDIVVAGGTENMSA
APYLLEKARWGQRMGDGKIVDEMIRDGLWESFNDYHMGITAENIAEQWGITREEQDEFSA
KSQQKAEKAVKEGRFKEEIVSVVIKSRKGEVVFDTDEFPRFGATKESLSKLKPAFKKDGT
VTAGNASGINDGAAALVIMSEEKANELGIKPLAKIVAYGTSGVDPKIMGYGPFYATKKTL
EKANLKIADIDLIEANEAFAAQSLAVAKDLGFDMDKVNVNGGAIALGHPIGCSGARILTT
LLYEMEKRNSKHGLATLCIGGGMGTAIIVERY
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgttgttattgctagtgctgtaagaacacctataggaaaatttggaggaaca
ttaaaaagtgtttcagctatagaattaggaagtattgttattaaagaagctttaaaaaga
gctaatgtaaaaccagaagatgttgatgaggttataatgggtaatgtacttcaagcaggt
cttggccaaaactcaacaagacaatctgcagtagcggcaggtataccagtagaagtacca
agctttacaataaataaggtttgtggttcaggacttagagcagtaagtttagcaactcaa
ttaataaaactcggagatgacgatatagtagtagcaggtggtacagaaaatatgtctgca
gctccatatcttttagaaaaagcaagatggggacagagaatgggcgatggaaaaattgta
gacgagatgataagagatggattatgggaatcttttaatgactatcatatgggaattacg
gctgaaaatatagcagagcaatggggaataacaagagaagagcaagacgaattttcagct
aaatcacaacaaaaagcagagaaagctgtaaaagaaggaagatttaaagaggaaatagta
tcagtagttattaaaagtagaaaaggcgaagtagtatttgatactgatgaatttcctaga
tttggtgctactaaagagagcctttctaaattaaaaccagctttcaaaaaagatggaaca
gttacagctggtaatgcttcaggtataaatgatggagcagctgctttagttatcatgagt
gaagaaaaggcaaatgaattaggaattaaacctttagctaaaatagttgcttatggtaca
agtggagtagatccaaagataatggggtatggaccattttatgcaactaaaaaaacttta
gaaaaagccaacctaaaaatagcagatatagatttaatagaagcaaatgaagcttttgcg
gctcaaagtttagcagtagctaaagatctaggttttgatatggataaagtaaatgtaaat
ggtggagctatagctttaggacatccaattggatgctcaggggctagaatattaactact
ttattatatgaaatggaaaaaagaaattcaaaacatggcttagctaccttatgtataggc
ggtggaatgggaacagctattattgttgaaagatattaa

DBGET integrated database retrieval system