KEGG   Clostridium botulinum H04402 065: H04402_03578Help
Entry
H04402_03578      CDS       T02076                                 

Definition
(GenBank) LSU ribosomal protein L22p (L17e)
  KO
K02890  large subunit ribosomal protein L22
Organism
cbj  Clostridium botulinum H04402 065
Pathway
cbj03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cbj00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    H04402_03578
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cbj03011]
    H04402_03578
Ribosome [BR:cbj03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    H04402_03578
  Bacteria
    H04402_03578
  Archaea
    H04402_03578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: CBZ05376
Position
complement(3735945..3736280)
Genome map
AA seq 111 aa AA seqDB search
MEAKAIVRYVRMSPSKIGVVLDLVRGKDVNEAFAILKYTPKDAAEVIYKALKSAVANAEN
NLNLDVNSLYISEAHVGQGPTLKRYQPHAQGRAFRIRKRTSHLTLVVKERV
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagctaaggctatagttagatatgtaagaatgtctccaagcaagattggagttgtt
cttgacttagtaagaggtaaagatgttaatgaagcatttgctatattaaaatatactcca
aaggatgcagcggaagtaatttataaagctttaaaatcagctgttgcaaatgcagaaaac
aatttaaatttagatgttaatagtttatatatatcagaagcacatgtaggtcaaggacca
acattaaaaagatatcaaccacatgctcaaggtagagcgtttagaataagaaagagaaca
agtcatttaactttagttgttaaagaaagagtttaa

DBGET integrated database retrieval system