KEGG   Clostridium botulinum B Eklund 17B (NRP): CLL_A0243Help
Entry
CLL_A0243         CDS       T00696                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cbk  Clostridium botulinum B Eklund 17B (NRP)
Pathway
cbk03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cbk00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CLL_A0243 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cbk03011]
    CLL_A0243 (rplV)
Ribosome [BR:cbk03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CLL_A0243 (rplV)
  Bacteria
    CLL_A0243 (rplV)
  Archaea
    CLL_A0243 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ACD22733
UniProt: B2TII0
Position
252642..252977
Genome map
AA seq 111 aa AA seqDB search
MEARAIAKYIRMSPMKVRVILDLIRGKQVKEAFAILEYTPREAAVVIKKVLKSAVANAEN
NLELNADNLYVSEAYVGEGPILKRFRPMDHGKAFRINKRTSHVTVVVKERA
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagctagagctatagctaaatatattagaatgtctccaatgaaagttagagtaatt
cttgatttaataagaggaaaacaagttaaagaagcttttgctattttagaatatactcca
agagaagcagcagtagtaattaaaaaagttttaaaatcagctgttgctaatgcagaaaat
aatttagaattaaatgctgacaacttatatgtttcagaagcttatgttggtgaaggtcca
atacttaagagattcagaccaatggatcacggtaaggcattcagaatcaacaaaagaact
agtcatgtaacagtagttgtaaaagaaagagcttaa

DBGET integrated database retrieval system