KEGG   Clostridium botulinum B Eklund 17B (NRP): CLL_A0471Help
Entry
CLL_A0471         CDS       T00696                                 

Gene name
ispE
Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cbk  Clostridium botulinum B Eklund 17B (NRP)
Pathway
cbk00900  Terpenoid backbone biosynthesis
cbk01100  Metabolic pathways
cbk01110  Biosynthesis of secondary metabolites
cbk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cbk00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CLL_A0471 (ispE)
Enzymes [BR:cbk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CLL_A0471 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C Mei5_like
Motif
Other DBs
NCBI-ProteinID: ACD25087
UniProt: B2TJM0
Position
472967..473809
Genome map
AA seq 280 aa AA seqDB search
MNIKAYAKINISLDVIGKREDGYHLLKMIMQNIDLYDIVQVEKIPNGIKLKCNKPYVPTD
ERNLAYKAAKLFKETYDIKSGIYINIEKNIPVSAGLAGGSTDAAAVLKIMNKMFNINVPQ
SELMDLGLKLGADVPYCICGGTALCEGIGEKVTKLKPFTDKILVVVKPPFGVSTKEVYKA
FDLSKVIFHPKTNELISNIEKNNIDFIANNMKNLLENVTLGRYKIISTIKEEINTCGALG
SMMSGSGPTVFGFFDDILKAQKCYEKMKEKYVDVFITRTI
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaaggcttatgcaaaaataaatatttctttagatgtaattggtaagagagaa
gatgggtatcatttgttaaaaatgataatgcaaaacatagatttatatgatatagttcaa
gttgaaaagattccaaatggaataaaactaaaatgtaataaaccttatgtgcccacagat
gaaagaaatttagcgtataaagctgctaaattatttaaagaaacttatgatataaaaagt
ggtatttatataaatatagaaaaaaatatacctgtttcagctggattagcaggtggtagt
actgatgcagcagcagttttaaaaatcatgaataagatgtttaatataaatgtaccacaa
tctgaattaatggatttaggattaaagctgggagcagatgtaccatattgtatttgtggt
ggtactgcattatgtgagggaattggagaaaaagttacaaaattaaagccatttacagat
aaaattttagtggtggtaaaacctccatttggagtatctactaaagaagtgtataaggct
tttgatttatcaaaggttatttttcatcctaaaactaatgaattaatatcaaatattgaa
aaaaataatattgattttatagcaaataatatgaaaaacttacttgaaaatgttactcta
ggtagatataaaattatttctacaataaaagaagaaattaatacatgtggtgctttagga
agtatgatgagtggaagcggtccaacagtatttggtttttttgatgatatattaaaagct
caaaagtgttatgaaaaaatgaaggaaaaatatgtagacgtgtttataaccagaacaatt
taa

DBGET integrated database retrieval system