KEGG   Clostridium botulinum B Eklund 17B (NRP): CLL_A0490Help
Entry
CLL_A0490         CDS       T00696                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbk  Clostridium botulinum B Eklund 17B (NRP)
Pathway
cbk00071  Fatty acid degradation
cbk00072  Synthesis and degradation of ketone bodies
cbk00280  Valine, leucine and isoleucine degradation
cbk00310  Lysine degradation
cbk00362  Benzoate degradation
cbk00380  Tryptophan metabolism
cbk00620  Pyruvate metabolism
cbk00630  Glyoxylate and dicarboxylate metabolism
cbk00640  Propanoate metabolism
cbk00650  Butanoate metabolism
cbk00900  Terpenoid backbone biosynthesis
cbk01100  Metabolic pathways
cbk01110  Biosynthesis of secondary metabolites
cbk01120  Microbial metabolism in diverse environments
cbk01130  Biosynthesis of antibiotics
cbk01200  Carbon metabolism
cbk01212  Fatty acid metabolism
cbk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLL_A0490
   00630 Glyoxylate and dicarboxylate metabolism
    CLL_A0490
   00640 Propanoate metabolism
    CLL_A0490
   00650 Butanoate metabolism
    CLL_A0490
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CLL_A0490
   00072 Synthesis and degradation of ketone bodies
    CLL_A0490
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLL_A0490
   00310 Lysine degradation
    CLL_A0490
   00380 Tryptophan metabolism
    CLL_A0490
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CLL_A0490
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CLL_A0490
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CLL_A0490
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbk04147]
    CLL_A0490
Enzymes [BR:cbk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CLL_A0490
Exosome [BR:cbk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLL_A0490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C SpoVAD ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ACD24544
UniProt: B2TJZ2
Position
490638..491819
Genome map
AA seq 393 aa AA seqDB search
MKEVVIVSAVRTALGSFGGALKTVPAVDLGATVIKEALNRAGVKPEAVEEVIMGNVIQAG
LGQNPARQSTLKAGLPNEVPAMTINKVCGSGLRAVSLAAQMIKAGDADVIVAGGMENMSA
APYVLPGARWGQRMGDAKMVDTMIKDGLWDAFNNYHMGVTAENIAKKWGLTREEQDAFSA
GSQQKAQKAIESGRFKDEIVPVMIPQRKGEPKVFDTDEFPRFGTTKESLGKLKPAFIKDG
TVTAGNASGINDGAAAFVVMSAEKAAELGVKPLAKILSYGSKGLDPAIMGYGPFHATKKA
LEEANLTIADLDLVEANEAFAAQSLAVAKDLGFDMEKVNVNGGAIALGHPVGASGARILV
TLLHEMEKRDAKKGLATLCIGGGMGTALIVERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttattgtaagtgcagtaagaacagctcttggaagctttggtggagca
ttaaaaactgttccagcagtagatttaggagcaactgtaattaaagaagcattaaacaga
gcaggtgttaaaccagaagctgttgaagaagttataatgggtaatgttatacaagctggt
ttaggacaaaacccagctagacaatcaactttaaaagcaggtttacctaatgaagttcct
gctatgacaattaataaagtttgtggttctggattaagagcagttagtttagcagctcaa
atgataaaagcaggagatgctgatgttatagttgctggtggtatggaaaacatgtcagct
gcaccatatgtattaccaggtgctagatggggccaaagaatgggcgacgctaaaatggtt
gatactatgattaaagatggattatgggatgcatttaacaactatcatatgggtgttact
gctgaaaatattgcaaaaaaatggggattaactagagaagaacaagatgcattctcagct
ggatctcaacaaaaagctcaaaaggcaattgaaagtggaagatttaaagatgaaatagtt
ccagttatgattccacaaagaaagggagaaccaaaagtatttgatactgacgaattccca
agatttggaacaactaaagaatctttaggtaaattaaaaccagctttcattaaagatgga
acagttacagcaggtaatgcttcaggaataaatgacggagcagcagctttcgttgttatg
agtgctgaaaaagcagctgaattaggagttaagccattagctaaaatactttcttatgga
tcaaaaggattagatccagctataatgggatacggaccattccatgcaactaagaaagct
ttagaagaagctaacttaactatagctgacttagatttagtagaagctaacgaagctttc
gcagctcaaagtttagcagttgctaaagatttaggatttgatatggaaaaagttaatgtt
aacggaggagctattgcattaggacatccagttggagcatctggtgctagaattcttgtt
acattacttcatgaaatggaaaaaagagatgctaaaaaaggtttagcaacactttgtata
ggtggaggaatgggaactgctcttatagttgaaagactataa

DBGET integrated database retrieval system