KEGG   Clostridium botulinum B Eklund 17B (NRP): CLL_A0636
Entry
CLL_A0636         CDS       T00696                                 

Definition
(GenBank) putative xanthine dehydrogenase, molybdopterin-binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
cbk  Clostridium botulinum B Eklund 17B (NRP)
Pathway
cbk00230  Purine metabolism
cbk01100  Metabolic pathways
cbk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CLL_A0636
Enzymes [BR:cbk01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     CLL_A0636
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ACD24242
UniProt: B2TKN6
Position
637371..639662
AA seq 763 aa
MTNNIVGNSVIRFDAVAKVTGKAKYVDDFFVNDMLVGKVLRSPHAHAIIKDIDTSKAKKL
EGVEAVITHEDLPKIKFATAGHPWSLDPSHRDIDDRLILTNKARFVGDAIAAVIAVDEIV
AAKALELIDVDYEVLEPIVDSEDALKENAPIIHEERPNNILSSFGSEIGNVEEDLKKADR
IFEGNFETSIVQHCHMENHSTYAYVDGEDRIVIVSSTQIPHIVRRIVGQALGIQWGKIKV
IKPYIGGGFGNKQDVVIEPLTAAMSLAVDGRPVRYTLDREECFIDTRTRHSMKIKFKTAV
SKEGKLISLDIKNLINNGAYASHGHSVALSAGGKFRGVYDFNSIKYSPTTVYTNLPAAGA
MRGYGAPQMCYALESHIEDICRELNMDSIEFRTKNFISEGYVEPLSKNVVRAFALPECIE
KGKELIKWDEKKKEYKNQSGDKRKGVGMACFSYFTGTHPVALEPAGARIVMNQDGSVQLQ
IGATEIGQGSDTVFGQMVAEILGLRIDMVHVISNQDTDITPFDTGSYASRQTFVSGAAVK
KCALEVKDKVLAFASSKCGLEASELDIENCKIVEKRLGRVICPLEEIAMESYYDRIKCCP
ITSDTSVNVRVNSIAYGATFAAVEVDIKTGKIEVLEIYNIHDSGMIMNPMLAEGQVHGGV
SMGLGYALSEQMLFDKKTGKPLNNNLLDYKLQTIMDTPTIGSAFVEKYEPAGGFGQKSIG
ENTTVSPAPAIRNAVLDATGVAFNKIPMNPQSVFEKFKEVGLV
NT seq 2292 nt   +upstreamnt  +downstreamnt
atgacaaataatatagtaggaaatagtgtaattagatttgatgctgtggctaaagttact
ggtaaagcaaaatatgtagatgacttttttgtaaacgatatgcttgtaggaaaagtttta
agaagtcctcatgctcatgccataattaaggatatagatactagtaaggcaaagaaatta
gaaggggtagaagcagttattacacatgaagatttacctaaaattaaatttgctactgct
ggacatccatggtctttagatccaagccatagggatatagatgatagattaattcttacc
aataaagctagatttgttggagatgccattgcagctgttatagctgtagatgaaatagta
gcagcaaaagctttagagcttatagatgttgattatgaagttcttgaaccaatagtagat
agtgaagatgctttaaaagaaaatgcgccaataattcatgaagaaagacctaacaatatt
ttaagttcttttggatcagaaattggaaatgtagaagaagatttaaaaaaggcagataga
atatttgaaggaaattttgaaacaagtatagttcaacattgtcatatggagaatcatagt
acttatgcttatgtggatggtgaagatcgtatagtaatagtttcttcaactcaaattcct
catattgtaagaagaattgttggacaagcattaggaattcaatggggtaagataaaagtt
attaaaccttatattggcggagggtttggaaataagcaagatgttgttattgaaccatta
acagcagctatgtctcttgcagtagatggaagaccagtgagatatacattagatagagaa
gaatgctttattgatacaaggacaagacattctatgaaaattaaatttaaaacagcggta
tcaaaagaggggaaattaatatcattagatataaaaaaccttataaataatggtgcttat
gcatctcatggtcattctgttgctttaagtgcaggcggaaaattcagaggcgtatatgat
tttaattcaataaaatacagtcctacaacagtgtatacaaatttaccagcagcaggtgca
atgaggggatatggagcacctcaaatgtgctatgcactagaaagtcatatagaagatatt
tgtagagaacttaatatggattctatagaatttagaactaagaattttataagcgaaggt
tatgttgaaccgcttagtaaaaatgtggttcgtgcatttgcattaccagaatgtattgaa
aaaggaaaagagttaattaaatgggatgaaaaaaagaaagaatataagaatcaaagtgga
gataaaagaaaaggagtaggcatggcttgcttcagttatttcacaggaactcatccagtg
gcattagaaccggctggagcaagaatagtaatgaaccaagatggatcagttcaattacaa
ataggagcaactgaaataggacaaggcagtgatacagtttttggacaaatggtagcagaa
attcttggattaagaatagatatggtacatgtaatttcaaatcaagatacagatatcact
ccttttgatactggatcttatgcatctaggcaaacatttgtaagtggagctgcagtcaaa
aaatgtgcattagaagttaaagataaagtattagcatttgcaagtagtaaatgtggtttg
gaagctagtgaattagatattgaaaattgtaaaattgtagaaaagagattaggtagagtg
atatgtccacttgaagaaattgccatggaatcatattatgataggattaaatgttgtcct
ataactagtgacacatcagttaatgttagagttaattcaatagcatatggagctacattt
gcagcagtagaagttgatattaaaacagggaaaatagaagttttagaaatatataatatt
catgattctggtatgattatgaatcctatgttagctgagggacaagtacatggtggagta
agtatgggacttggatatgcattatcagaacaaatgttattcgataagaaaactggtaag
ccattaaataataatcttttagattataagttacaaactataatggatactcctactatt
ggttcagcttttgtagaaaaatatgaaccagcaggtggatttgggcaaaaatctattggt
gagaatacaacagtgtcaccagcaccagcaattcgtaatgctgttttggatgcgactggg
gttgcatttaataaaatacctatgaatccacaatctgtttttgaaaaatttaaggaagtc
ggattagtgtaa

DBGET integrated database retrieval system