KEGG   Clostridium botulinum B Eklund 17B (NRP): CLL_A1951Help
Entry
CLL_A1951         CDS       T00696                                 

Definition
(GenBank) conserved domain protein
Organism
cbk  Clostridium botulinum B Eklund 17B (NRP)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_19 HTH_3 HTH_31 HTH_26 HTH_37 ArsR KorB CtsR
Motif
Other DBs
NCBI-ProteinID: ACD24069
UniProt: B2TM27
Position
complement(2025308..2025511)
Genome map
AA seq 67 aa AA seqDB search
MDTIEKFREEMTKTREKNNLSKSDLARKISKSPSFICDIESKRKKPSLETTVDIAHALGL
SLDKIFK
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atggatacaatagaaaaattcagggaggaaatgacaaaaactagagaaaaaaataatttg
agtaaaagtgatttagctagaaaaatttcaaagagtccaagctttatatgtgatattgag
tcaaaaaggaaaaaacctagtttagaaacaactgttgatatagcacatgcattaggatta
tctcttgataaaatttttaaataa

DBGET integrated database retrieval system