KEGG   Clostridium botulinum B Eklund 17B (NRP): CLL_A2056Help
Entry
CLL_A2056         CDS       T00696                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cbk  Clostridium botulinum B Eklund 17B (NRP)
Pathway
cbk00010  Glycolysis / Gluconeogenesis
cbk00052  Galactose metabolism
cbk00500  Starch and sucrose metabolism
cbk00520  Amino sugar and nucleotide sugar metabolism
cbk00521  Streptomycin biosynthesis
cbk01100  Metabolic pathways
cbk01110  Biosynthesis of secondary metabolites
cbk01120  Microbial metabolism in diverse environments
cbk01130  Biosynthesis of antibiotics
cbk01200  Carbon metabolism
Module
cbk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cbk_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cbk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLL_A2056
   00052 Galactose metabolism
    CLL_A2056
   00500 Starch and sucrose metabolism
    CLL_A2056
   00520 Amino sugar and nucleotide sugar metabolism
    CLL_A2056
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CLL_A2056
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CLL_A2056
Enzymes [BR:cbk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CLL_A2056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ACD25113
UniProt: B2TLF9
Position
complement(2150619..2151509)
Genome map
AA seq 296 aa AA seqDB search
MKYYIGIDIGGTNLRAAILDEKCNLVDKLKISNEVEKGPEYNLDKLILEIKERWSDKEII
SVGVGCPGPLDIRSGTILVTPNLRTWEYFKLKEYLENKFDLPVFVNNDANVAGYSEAMVG
AGKGAESVYYMTLSTGIGGGFIYKGEIVSGFNSIAAEIGNMIINEDTYKHSNMNYGGLEG
QCSGVNIARISSEIIGGELTTKDVFEGAEKGNMELQKMLSEWVTNVSKAIANIIVTVDPE
VIVLGGSVIINNPSYLNKIKEETQKRVFDGIKINIKLAEIGDDTGLIGAGLLGKLK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattacataggtatagatataggcggaacaaacttaagagcagcaatattagat
gaaaaatgtaacttagtagataagcttaaaatatcaaatgaagttgaaaaagggccagaa
tataatttagacaagctaatattagaaattaaagaaaggtggtcagataaagaaattatt
tcagtaggtgtggggtgtccaggaccacttgatattagaagtggaacaatattagttact
ccaaatttaaggacatgggaatattttaaattaaaagaatacctagaaaataagtttgat
ttacctgtgtttgtaaataatgatgccaatgtagcaggatatagtgaagcaatggttgga
gcaggaaaaggtgcagaaagtgtttactatatgacactatcaacagggattggtggaggc
tttatatataaaggtgaaattgtttctggctttaatagcatagcagctgaaataggtaat
atgattattaatgaagatacatataaacattctaatatgaactatggtggacttgaaggt
caatgcagtggagtaaatatagcaaggatatcaagtgaaattataggtggagaattaact
acaaaagatgtctttgagggtgcagaaaagggcaatatggaattgcaaaaaatgttaagt
gaatgggttacaaatgtttcaaaagcaatagcaaatattatagttacagttgatccagaa
gttatagttcttggtgggtcagtaattataaataatccatcttaccttaataagattaaa
gaagaaactcagaaaagagtctttgatggtattaaaattaatattaagttagctgagatt
ggtgatgacactggacttataggtgcagggttattaggtaagttaaaataa

DBGET integrated database retrieval system