KEGG   Clostridium botulinum B Eklund 17B (NRP): CLL_A2118Help
Entry
CLL_A2118         CDS       T00696                                 

Definition
(GenBank) phospholipase C zinc-binding
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
cbk  Clostridium botulinum B Eklund 17B (NRP)
Pathway
cbk00562  Inositol phosphate metabolism
cbk00564  Glycerophospholipid metabolism
cbk01100  Metabolic pathways
cbk01110  Biosynthesis of secondary metabolites
cbk02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cbk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CLL_A2118
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CLL_A2118
   00565 Ether lipid metabolism
    CLL_A2118
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CLL_A2118
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:cbk02042]
    CLL_A2118
Enzymes [BR:cbk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     CLL_A2118
Bacterial toxins [BR:cbk02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   CLL_A2118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zn_dep_PLPC
Motif
Other DBs
NCBI-ProteinID: ACD23337
UniProt: B2TLM1
Position
complement(2215729..2216487)
Genome map
AA seq 252 aa AA seqDB search
MKVLEKSYSYVFKKILKTVNPVKKRIIKAECIVHKFINTQSLIVLKNDGYMEGYKLMKSY
ISDINAGVVWADQDLKSSNHFYNPHRNKGLYGSSDAKKECISYYTKALNEYFDGSIKNSM
FYLGVACHLIQDLTVPQHANVHLLNNHKSYENWVIRTHRHHDEFKIEKGGIYFNSLKQYI
DFNSKEAINIYRKHSNVKNRQVRFHIITSKVLTMAQATTAGLMLKFYKDIQEINPIAKEN
KKQFENILSKFL
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttttagaaaaatcatattcatacgtatttaaaaaaatattaaaaactgtcaat
cctgtaaaaaagagaataataaaagctgagtgcatagttcataaatttataaatactcaa
tccttaatagtattaaaaaatgatggttatatggaaggttataaacttatgaaatcatat
ataagtgatattaatgctggagtagtttgggctgatcaagatttaaaaagcagtaatcac
ttttataatccacataggaacaagggtttatacggtagtagtgatgcaaaaaaagaatgt
atatcttattatactaaagcattaaatgaatatttcgatggtagtattaaaaattcaatg
ttctatttaggtgttgcttgtcatttaattcaagatttgacagttcctcagcacgctaat
gttcacttattaaataatcataaaagttatgaaaattgggtaattagaacccacagacat
catgatgagtttaaaatagaaaaagggggaatctattttaattcattaaaacagtatatt
gattttaatagcaaagaagccataaacatatacagaaagcattcaaatgtaaaaaatagg
caagttaggtttcacataattacttcaaaggtcttaacaatggctcaagccactacagct
ggtttgatgcttaagttttataaagacatacaagaaatcaaccctatagctaaagaaaat
aaaaagcaatttgaaaatatattaagtaagtttttgtag

DBGET integrated database retrieval system