KEGG   Clostridium botulinum A3 Loch Maree: CLK_0057Help
Entry
CLK_0057          CDS       T00670                                 

Definition
(GenBank) PHP domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Brite
KEGG Orthology (KO) [BR:cbl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CLK_0057
Enzymes [BR:cbl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     CLK_0057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP DUF3216 PHP_C SLATT_6
Motif
Other DBs
NCBI-ProteinID: ACA54850
UniProt: B1KW95
Position
791461..792279
Genome map
AA seq 272 aa AA seqDB search
MIYADFHVHTNHSDGICEIANVLDMAKEKGIKAIAITDHDTVDQFDEINELGRKMDLEVV
KGVEMSCYDYDVFKKVHIVGLWLNKNATHVKKLCDKTLKCRDNYHRDLIKELSEKGYGIT
YEDAKRYSKYSIVFKMNIFQALKEKYKDEMTKERYNELFASKTSKETDFKMGYTPVMQGI
EAIKKDGGIPIIAHPCQYDNYDEIEKYVEYGLQGIEINHSKMKKIDYKKTLNFAAKYNLA
KSGGSDFHDPDLIEFGCYGLTKEQYEELKHFR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgatatacgctgatttccacgtacacacaaatcatagtgatggtatttgtgaaattgct
aatgttcttgatatggctaaagagaaaggaataaaagcaatagctattactgatcatgat
accgttgatcaatttgatgaaattaatgaattgggcagaaaaatggatcttgaagtagta
aaaggtgtagaaatgagttgttatgattatgatgtgtttaaaaaggttcatattgttgga
ttatggcttaataaaaatgctacacatgtaaaaaaattatgtgataagactttaaaatgt
agagataattaccatagagatttaataaaagaattgtctgaaaagggatatggtataaca
tatgaagatgctaaaagatattccaaatacagtattgtttttaaaatgaatatttttcaa
gctctaaaagaaaaatataaagatgagatgacaaaagaaagatataatgagctttttgct
tcaaaaacatcaaaggaaactgatttcaagatgggatatactcctgtaatgcaaggtatt
gaagcaataaaaaaagatggtggtataccaattattgctcatccttgccaatatgataat
tatgatgagattgaaaaatatgttgagtatggattacagggaattgaaataaatcattca
aagatgaagaaaatagattacaaaaaaaccttgaattttgcagctaaatataacttagcc
aaaagtggaggaagtgattttcatgacccagatttaattgaatttgggtgctatggttta
accaaagagcagtatgaagaactaaaacattttagataa

DBGET integrated database retrieval system