KEGG   Clostridium botulinum A3 Loch Maree: CLK_0421Help
Entry
CLK_0421          CDS       T00670                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
cbl00260  Glycine, serine and threonine metabolism
cbl00750  Vitamin B6 metabolism
cbl01100  Metabolic pathways
cbl01110  Biosynthesis of secondary metabolites
cbl01120  Microbial metabolism in diverse environments
cbl01230  Biosynthesis of amino acids
Module
cbl_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cbl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLK_0421
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CLK_0421
Enzymes [BR:cbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CLK_0421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACA53902
UniProt: B1KY78
Position
1130589..1131707
Genome map
AA seq 372 aa AA seqDB search
MIERNKSIKNLYCIRCNKKYGISDYFRGCEKCLNDGLPASVTFHYGVGESVNNINEMFPY
SMQSMLGEGNTPIISHKKISDIYGIESFYLKNEFQNPTGSHKDRMSPYIVARAIEMKRKG
VVVASSGNAGISIASYASYKGVKSIVVTTKGINPVYERAIEATGAQIIITETSDERWNIV
KKLVDIEGWYPATNYINPPVGSNPFGVQGYKKIAFEIYEFFNEKLPTHILIPVSRGDLLW
GVYEGFKNLLQLGYIIEIPKLIAVEPIPRIESVLKGKSYIKKFKGDYSKTPSIGGDTVTY
QSIKAIKETNGCAITVNAEKIPSALKLIGSSGVYLETSSALAIQGLCILREKEIINENSR
VLMIATSHGYKN
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgattgagagaaataaatccataaaaaatttgtattgtattaggtgcaataaaaagtat
ggaatatcagattattttagggggtgtgaaaaatgtttaaatgatggactaccagcaagt
gtaacatttcattatggagtaggggaaagtgttaataatataaatgagatgtttccctat
tcaatgcaatcaatgttaggtgaaggtaatactccaataattagtcataaaaagatcagt
gatatatatggaattgaaagtttttatttgaaaaacgaatttcaaaatccaacaggatca
cataaggatagaatgagtccttatattgttgctagggcaatagagatgaaaagaaaaggg
gtggtagtagcctcaagtggaaatgcaggtatttctatagcatcttatgctagttataag
ggggtgaaatctatagtagttactactaagggaataaacccagtttatgagagagccatt
gaagctactggtgcacaaattataattaccgaaacatcagatgaaagatggaacatagtt
aagaaattagtagatatagaaggttggtacccagcgacaaactatataaatccacctgtt
ggcagcaatccatttggagtacaaggctacaaaaaaatagcctttgagatatatgaattt
tttaatgaaaaactacccactcatatattaattccggtttcaagaggagacttactatgg
ggagtatatgaaggcttcaaaaacttacttcaactaggttatattatcgaaataccaaaa
ttaattgcagttgaacctataccaagaattgaatctgttctaaaaggtaaaagttatatc
aaaaaatttaaaggagattactcaaaaactccttccataggaggcgatactgttacatat
caatcaataaaggcgataaaagaaacgaatggatgtgcaataactgtaaatgcagagaaa
ataccttccgcattaaaattaattggaagtagtggtgtatacttagaaacatcttcagca
ctagctattcagggactttgtattcttagggaaaaggaaattattaatgagaatagtcgt
gtacttatgattgccacttcacatggatataaaaactaa

DBGET integrated database retrieval system