KEGG   Clostridium botulinum A3 Loch Maree: CLK_0640Help
Entry
CLK_0640          CDS       T00670                                 

Definition
(GenBank) putative beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
cbl00010  Glycolysis / Gluconeogenesis
cbl00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cbl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLK_0640
   00500 Starch and sucrose metabolism
    CLK_0640
Enzymes [BR:cbl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     CLK_0640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase Albumin_I_a
Motif
Other DBs
NCBI-ProteinID: ACA56374
UniProt: B1KZG1
Position
1380357..1381802
Genome map
AA seq 481 aa AA seqDB search
MKTSFPENFLWGGAVAANQCEGAYNIDGKGLSVQDIAPKGIKAGPTLEPTQDNMKLIGID
FYHRYKEDIKLFAEMGFKVFRLSIAWSRIFPMGDEKEANEKGLQFYDDVFDECLKYGIQP
IVTLSHYETPLHLSKAYDGWKSREMIGFFNKYVCTVFNRYKNKVKYWLTFNEINSITHAP
FLSGGIYTPIEKLSKQEIYQAIHHELVASAMAVKACHEIIPDAKIGCMILGMPVYPLKPS
PEDMWETLNKERENFFFSDIQVRGYYPSYSKRFFKKNNIKLNITNKDIEILKNTVDFISF
SYYMSICESSDKSIGAGEGNIIGGIPNPYLKASEWGWQIDPKGLRYYLNILYDRYQKPLF
IVENGLGAVDELVELEDGTKTVLDDYRISYLRDHLIQVSEAIEDGVDLMGYTSWGCIDLV
SFTTSQLKKRYGFIYVDRNDDGTGTLERYKKKSFYWYKEVISSNGDIEALCSNISIEKDK
I
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaagttttccagaaaattttttgtggggtggtgcagttgcagctaaccaatgt
gaaggagcttataatattgatggtaaaggattaagcgtgcaagatatagcgccaaaggga
ataaaagctggtcctacattagagcctacacaagataatatgaaacttataggtatagat
ttttatcatagatataaagaagatattaagctttttgcagaaatggggtttaaggttttt
aggttatcaattgcttggtcaaggatatttccaatgggggatgaaaaagaagcaaatgag
aagggactacaattttatgatgatgtttttgatgagtgcttaaagtatggaatacagcca
atagtaacattatcccattatgaaactccattgcatttatctaaagcttatgatggatgg
aaaagtcgtgagatgattggattttttaataagtatgtttgtacagtttttaatcgatat
aaaaataaagtaaaatattggttaacctttaatgaaattaattcaattactcatgcacca
tttttaagtggtggaatttatacaccaatagaaaaattaagtaagcaagagatttatcaa
gctattcatcatgaattagtagcaagtgcaatggcagtaaaagcgtgtcatgaaattatt
cctgatgctaaaataggatgtatgattttggggatgcctgtatatccattgaaaccatca
ccagaagatatgtgggagactcttaataaagaaagagagaattttttcttttcagatatt
caagttcgtggttattatccctcatattcaaaaagattctttaaaaaaaataatattaag
ttaaatattacaaataaagatatagaaatattaaaaaatactgtagattttatttcattt
agctattatatgagtatttgtgaatctagcgataaatctattggggcaggtgagggaaat
attattggaggaatacctaatccttatttaaaagcaagtgaatggggatggcaaattgat
cctaaaggactaaggtattatcttaatatattgtatgatcgttatcaaaagccattattt
atagttgagaatggattaggagctgtagatgaattagttgaactagaggatggaacaaaa
acagtattagatgactatagaatttcatatttaagagatcatttaattcaagtatcagaa
gcaatcgaggatggagtggacttaatgggatatacttcttggggatgcattgatttggtt
agttttactacttctcaattaaaaaaacgttatggatttatttatgtagatcgtaatgat
gatggaacagggacattagaacgttataagaaaaaaagcttttattggtataaagaagta
atttcaagtaatggagatattgaagcattatgctcaaatattagtattgaaaaagataaa
atataa

DBGET integrated database retrieval system