KEGG   Clostridium botulinum A3 Loch Maree: CLK_0729
Entry
CLK_0729          CDS       T00670                                 

Definition
(GenBank) putative xanthine dehydrogenase, iron-sulfur binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
cbl00230  Purine metabolism
cbl01100  Metabolic pathways
cbl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CLK_0729
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3 Fer2_4
Other DBs
NCBI-ProteinID: ACA53876
UniProt: B1L004
Position
1466647..1467120
AA seq 157 aa
MSLKRKIKLTVNDKKYEIEVDIRESLSEVLRSRLHLTGVKQGCLVGECGACTVLIDGVPT
DSCIYLAAWADGKTIKTIEGVQKNGELSEVQKAFIDEGAVQCGFCTPGLVLTTTALVESK
KNYTDEEIKREISGHLCRCTGYNKIFNATKKAILKRK
NT seq 474 nt   +upstreamnt  +downstreamnt
atgagtttaaaaagaaaaataaaacttacagttaatgataaaaagtatgaaatagaagta
gatattagagaatctttatcagaagtgttaagaagtagattacatttaacaggtgttaag
caaggatgtcttgtgggagaatgtggagcatgtactgttttaatagatggtgtcccaaca
gactcatgtatttacttggcggcttgggctgatggtaaaacaataaaaactattgagggg
gtacaaaaaaatggtgagctttcagaggttcaaaaagcttttatagatgaaggtgctgta
caatgtggattctgtacaccaggtttagttttaactacaacagctttagtagaaagcaaa
aaaaactatactgatgaggaaataaaaagagaaatatcaggtcatttatgtagatgtact
ggatataataaaatatttaatgctacgaaaaaagctattttaaaaagaaaataa

DBGET integrated database retrieval system