KEGG   Clostridium botulinum A3 Loch Maree: CLK_1673Help
Entry
CLK_1673          CDS       T00670                                 

Definition
(GenBank) putative threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
cbl00260  Glycine, serine and threonine metabolism
cbl01100  Metabolic pathways
cbl01110  Biosynthesis of secondary metabolites
cbl01120  Microbial metabolism in diverse environments
cbl01130  Biosynthesis of antibiotics
cbl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLK_1673
Enzymes [BR:cbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CLK_1673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2 Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ACA56169
UniProt: B1KVY1
Position
complement(2499470..2500498)
Genome map
AA seq 342 aa AA seqDB search
MYSFKCDYSEGCHPRILKALAESNITQEEGYGKDSHTKNAISIIKKLVQNENVDIHLISG
GTQTNLISISSFLRPHEACICVHSGHIAGPETGSIEYTGHKVITVDSTNGKITTDKIQQV
LDFHRNEHFVKPKLVYISNSTEVGTVYTKEEMRSLSEFCKEKNLILYVDGARLGSALAVK
ESNLTLKDMCDFSDAFCIGGTKNGALIGEALVIKNQNLKEDFRYNIKQKGALLAKGRVLG
IQFEELFKDNLYFDLANHANEMASILTKGIKEANCKFFVESKSNQIFPILSNENIKILQE
RFSFNIWEKVDNKNYAIRLVTSWATTKEAVFEFIQELKQLVE
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtatagttttaaatgcgattatagtgaaggatgtcatcctagaattttaaaggcatta
gcagagtcaaatattactcaagaggaaggttatggaaaagattctcatactaaaaatgct
atttctataataaagaaattagtacaaaatgaaaatgtagatattcatcttatatctgga
ggaactcaaacaaatttaatttcaattagctcattcttgagacctcatgaagcttgtata
tgtgtacattcaggtcatattgcaggccctgagactggttccattgaatatactggtcat
aaagtaattactgtggattcaaccaatggaaaaattactacagataaaattcaacaggta
ttagattttcatagaaacgagcattttgtaaaaccaaagcttgtttatatttctaattca
acagaagtgggaacagtatataccaaagaagaaatgagaagtttaagtgaattttgtaaa
gagaaaaaccttattttgtatgtagatggtgcaaggcttggttctgctcttgctgttaaa
gagtcaaatttaactttaaaagatatgtgcgatttttcagatgcattttgcattggtgga
actaaaaatggggctcttataggagaagctttagttataaaaaatcaaaatttaaaagaa
gattttagatataatataaaacaaaaaggagctcttcttgctaagggaagagttttagga
atacaatttgaggagctatttaaggataatctttattttgatcttgcaaatcatgcaaat
gaaatggcaagcattttaactaaagggataaaagaagctaattgtaagttttttgtggaa
tctaagagtaatcaaattttccctatcttgagtaatgaaaacataaaaatactacaagaa
agattctcttttaatatttgggagaaggtggacaataaaaattacgctattagattagtt
acctcctgggcaacaacaaaagaagcagtatttgaatttattcaagaattaaaacaatta
gtggaatag

DBGET integrated database retrieval system