KEGG   Clostridium botulinum A3 Loch Maree: CLK_2597Help
Entry
CLK_2597          CDS       T00670                                 

Gene name
bcd
Definition
(GenBank) butyryl-CoA dehydrogenase
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
cbl00071  Fatty acid degradation
cbl00280  Valine, leucine and isoleucine degradation
cbl00410  beta-Alanine metabolism
cbl00640  Propanoate metabolism
cbl00650  Butanoate metabolism
cbl01100  Metabolic pathways
cbl01110  Biosynthesis of secondary metabolites
cbl01120  Microbial metabolism in diverse environments
cbl01130  Biosynthesis of antibiotics
cbl01200  Carbon metabolism
cbl01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CLK_2597 (bcd)
   00650 Butanoate metabolism
    CLK_2597 (bcd)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CLK_2597 (bcd)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLK_2597 (bcd)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CLK_2597 (bcd)
Enzymes [BR:cbl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     CLK_2597 (bcd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_2 Acyl-CoA_dh_M
Motif
Other DBs
NCBI-ProteinID: ACA55063
UniProt: B1L0Z9
Position
complement(3485160..3486299)
Genome map
AA seq 379 aa AA seqDB search
MEFGLSPEQKLVKQMLMEFVENEVEPIAADIDKTERYPIETVEKMAKYGIMGMPFPKEYG
GAGTDYLSYVIAVEELAKECATTSVILSAHTSLCCAPIFEFGTEEQKKKYLPDLLSGKKI
GAFGLTEPNAGTDASAQQSIAVLEGDHYILNGSKIFITNGGAADTFVIFAMTDRSKGVKG
ISAFILEKGMPGFSIGKTEDKMGIRASSTTELIFEDVKVPKENLLGKEGKGFGIAMKTLD
GGRIGIAAQALGIAEGALDHAIAYMKERKQFGKNLTKFQGLQWYIADMKVRVDAAKYLVY
KSAWKKSAGENYTVDAAEAKLYAAETAMYVTNKSLQVLGGYGYTKDYPLERMLRDARITE
IYEGTSEVQKMVIANNLLH
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggaatttggtttatcaccagaacaaaagcttgttaagcagatgctaatggaatttgta
gaaaatgaagttgaaccaatcgctgctgatatagataaaacagagagatatccaattgaa
acagtagaaaaaatggctaaatacggaataatgggaatgccatttccaaaggaatatggt
ggagcaggtactgattatttgagctatgttatagcagtagaagaacttgcaaaagaatgt
gcaactacatctgttattttatcagcacatacatctttatgttgcgctccaatattcgaa
tttggaacagaagagcaaaagaaaaaatatttaccggatcttttaagtggtaaaaaaata
ggtgcttttggtttaacagaacctaatgctggtacagatgcatctgctcaacaaagtata
gctgttttagaaggagatcattatatattaaatggatcaaagatatttataactaatggt
ggagcagcagatacatttgtaatatttgctatgacagatagaagtaagggcgttaaagga
atttccgcatttatattagaaaagggaatgcccggatttagcattggcaagacagaggat
aaaatgggaataagagcatcatcaactactgaacttatatttgaagatgtaaaagttcca
aaagaaaatttacttggtaaagaaggaaaaggatttggtatagccatgaaaactttagat
ggcggaagaattggaatagcagctcaagcattaggaatagcagaaggcgctttagatcac
gctattgcatatatgaaagaaagaaaacaattcggtaaaaatcttactaaatttcaagga
ttgcaatggtatatagcagatatgaaagtgagagtagatgctgctaaatatcttgtttac
aaatcagcatggaaaaaatctgcaggagaaaattacacagttgatgcagctgaggctaaa
ctgtatgcagctgaaacagctatgtatgtaacaaataaatctctacaagtattgggtgga
tatggatacactaaagattatccattagaaagaatgttaagagatgctagaataactgaa
atatatgaaggaacttcagaagtacaaaaaatggttatagctaataacttattacactag

DBGET integrated database retrieval system