KEGG   Clostridium botulinum A3 Loch Maree: CLK_2598Help
Entry
CLK_2598          CDS       T00670                                 

Definition
(GenBank) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
cbl00071  Fatty acid degradation
cbl00072  Synthesis and degradation of ketone bodies
cbl00280  Valine, leucine and isoleucine degradation
cbl00310  Lysine degradation
cbl00362  Benzoate degradation
cbl00380  Tryptophan metabolism
cbl00620  Pyruvate metabolism
cbl00630  Glyoxylate and dicarboxylate metabolism
cbl00640  Propanoate metabolism
cbl00650  Butanoate metabolism
cbl00900  Terpenoid backbone biosynthesis
cbl01100  Metabolic pathways
cbl01110  Biosynthesis of secondary metabolites
cbl01120  Microbial metabolism in diverse environments
cbl01130  Biosynthesis of antibiotics
cbl01200  Carbon metabolism
cbl01212  Fatty acid metabolism
cbl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLK_2598
   00630 Glyoxylate and dicarboxylate metabolism
    CLK_2598
   00640 Propanoate metabolism
    CLK_2598
   00650 Butanoate metabolism
    CLK_2598
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CLK_2598
   00072 Synthesis and degradation of ketone bodies
    CLK_2598
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLK_2598
   00310 Lysine degradation
    CLK_2598
   00380 Tryptophan metabolism
    CLK_2598
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CLK_2598
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CLK_2598
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CLK_2598
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbl04147]
    CLK_2598
Enzymes [BR:cbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CLK_2598
Exosome [BR:cbl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLK_2598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ACA54010
UniProt: B1L100
Position
complement(3486492..3487670)
Genome map
AA seq 392 aa AA seqDB search
MKNVVIASAVRTPIGKFGGTLKDVSAVELGSIVIKEALKRANVNPEDVDEVIMGNVLQAG
LGQNTTRQSLVAAGIPVEVPGFTINKVCGSGLRAVSLAAQLIKVGDDDIVVAGGTENMSA
APYILQKARWGQRMGDGKIIDEMIKDGLWESFNDYHMGITAENIAEQWGITREEQDKFSA
KSQQKAEKAVKEGRFKEEIVPVVIKSRKGEVVFDTDEFPRFGATEESLSKLKPAFKKYGT
VTAGNASGINDGAAALVIMSEEKANELGIKPLAKIVAYGTSGVDPKIMGYGPFYATKKTL
EKANLKIEDMDLIEANEAFAAQSLAVAKDLGFDMDKVNVNGGAIALGHPIGCSGARILTT
LLYEMEKRDSRNGLATLCIGGGMGTAIIVERY
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgttgttattgctagtgctgtaagaacacctataggaaaatttggaggaaca
ttaaaagatgtttcagctgtagaattaggaagtattgttattaaagaagctttaaaaaga
gctaacgtaaaccctgaagatgttgatgaagttataatgggaaatgtactacaagcaggt
cttggtcagaacacaacaagacaatctttagtagctgctggtataccagtagaggtacca
ggcttcacaataaataaagtttgtggttcaggacttagagcagtaagcttagcagctcaa
ttaataaaagtaggagacgatgatatagtagtagcaggtggaacagaaaatatgtctgca
gctccatatattttacaaaaagcaagatggggccaaagaatgggagacggaaaaattata
gatgagatgataaaagatggactatgggaatcttttaatgactatcatatggggattaca
gctgaaaatatagcagagcaatggggaataacaagagaagagcaagataaattttcagct
aaatcacaacaaaaagcagagaaagctgtaaaagaaggaagatttaaagaggaaatagta
ccagtagttattaaaagtagaaaaggtgaagtagtatttgatactgatgaattccctaga
tttggcgctactgaagagagcctttctaaattaaaaccagcttttaaaaaatatggaaca
gttacagctggtaatgcatcaggcataaatgatggagcagctgctttagttatcatgagt
gaagaaaaggcaaatgaattaggaattaaacctttagccaaaatagttgcttatggcaca
agtggagtagatccaaagataatgggatatggacctttttatgcaactaaaaaaacttta
gaaaaagcaaatctaaaaatagaagatatggatttaatagaagcaaatgaagcttttgcg
gctcaaagtttagcagtagctaaagatctaggttttgatatggataaagtaaatgtaaac
ggtggagctatagctttaggacatccaattggatgctcaggggctagaatattaactact
ttattatatgaaatggaaaaaagagattcaagaaatggcttagctaccttatgtataggc
ggtggaatgggaacagctattattgttgaaagatattaa

DBGET integrated database retrieval system