KEGG   Clostridium botulinum A3 Loch Maree: CLK_A0185Help
Entry
CLK_A0185         CDS       T00670                                 

Definition
(GenBank) putative guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
cbl00230  Purine metabolism
cbl01100  Metabolic pathways
Module
cbl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cbl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CLK_A0185
Enzymes [BR:cbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CLK_A0185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_18 AAA_33 RsgA_GTPase ABC_tran AAA_28 CoaE AAA_22 Zeta_toxin AAA_29 AAA_5 AAA_15 G-alpha AAA_16 Guanylate_kin RNA_helicase APS_kinase Cytidylate_kin AAA_24 DHQS AAA_23 MMR_HSR1 Sigma54_activat CPT dNK
Motif
Other DBs
NCBI-ProteinID: ACA57497
UniProt: B1L2S4
Position
pCLK:complement(154295..154888)
Genome map
AA seq 197 aa AA seqDB search
MQDNNTDIIICLVGESGSGKSTIAELLEKEGYNYIESYTTRKPRYKGERGHIFLNSINDR
NDIDILDDGYYPKENVIAYACYKDEHYYATKEQYKNKGTSIYIVEVKGVNELRSEIDDAK
ILVLYLRADEQIRRGRMIKRYIDVNGNTSKNYLIAERKAQERIIHDKENFQIIPCDYVID
TNMPITEVLKSIKTIIE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcaagataacaatacggatataattatttgtttagtaggggaatctgggtccggtaaa
tctactatagcagagttattggagaaggaaggatataattatatagaaagctatacaacc
aggaaaccacgatataaaggtgagagaggacacatatttttaaatagtataaatgatagg
aatgatattgatatattagatgatggttattatcctaaagaaaatgtaatagcgtatgct
tgctataaagatgagcactactatgctactaaagagcaatataaaaataagggaacatct
atatatatagtagaagttaagggagttaatgaattaagatcagaaatagatgatgcaaaa
atattagtattatatttaagagcagatgagcaaattagaagaggtagaatgataaaaaga
tatattgatgtaaatggaaatacttctaagaactatttaatagcagaacgaaaggcacaa
gaaagaataatacacgataaagaaaattttcagataataccgtgtgattatgtaatagat
actaatatgccaataactgaagtattaaaaagtataaaaacaataatagaataa

DBGET integrated database retrieval system