KEGG   Clostridium botulinum F 230613: CBF_0029Help
Entry
CBF_0029          CDS       T01865                                 

Gene name
psd
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
cbm  Clostridium botulinum F 230613
Pathway
cbm00564  Glycerophospholipid metabolism
cbm01100  Metabolic pathways
cbm01110  Biosynthesis of secondary metabolites
Module
cbm_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:cbm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CBF_0029 (psd)
Enzymes [BR:cbm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     CBF_0029 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase BRCT_assoc
Motif
Other DBs
NCBI-ProteinID: ADF97872
Position
complement(26024..26911)
Genome map
AA seq 295 aa AA seqDB search
MIKYYNRKNKDYDIEKVAGEKYLNWTYSSPIGMNLLEVFIKKKIFSKIYGFYCDRRLSQK
KINKFINDFQIDMSLSENQLSNFKCFNDFFTRKLKKEARPIKTDKNLLISPGDGKLLAYE
NLNLNSVTEVKGINYSFYELINNDSLAKEYNNGTCLVLRLCPTDYHRFHFIDNGICENTI
KLNGFYYSVNPIALSKIPSVFCKNKREYSIFHSENFGDIIFMEVGATCVGSIIQTYKPNT
KVLKGDEKGYFKFGGSTVILFFKKNTIKIDDDILSQSKLGYETSVIMGEPIGNKK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgataaaatattataatagaaaaaataaagattatgatatagaaaaagttgctggagaa
aaatatttaaattggacttattcctcacctattggtatgaatcttttagaagtatttata
aaaaagaaaattttttcaaaaatatatggattttattgtgatagaagactaagtcagaaa
aaaataaataaatttattaatgattttcaaattgacatgtctttaagtgaaaatcaatta
agtaattttaagtgttttaatgatttttttactagaaaattaaaaaaagaagctagacct
ataaaaactgataaaaatttattaatatccccaggtgatggtaaactacttgcatatgaa
aatttaaatctaaattcagtaactgaagtaaagggaataaattatagtttttatgaatta
ataaataatgattcattggcaaaagaatataacaatggaacttgcttagttttaagactg
tgccccacagattatcatagatttcattttatagacaatggtatctgtgaaaatactata
aaactaaatggtttttactattcagtaaatccaattgcgttatctaaaattcctagtgtg
ttttgcaaaaataaaagagagtattccatttttcatagcgaaaatttcggtgatataata
tttatggaagttggagctacatgtgtaggttctataatacagacttataagcccaacact
aaagttttaaagggtgatgaaaaaggttattttaaatttggaggatccacagtaatttta
ttcttcaaaaaaaatactataaaaattgatgatgatatattaagtcaaagtaaattagga
tatgaaacatctgttataatgggagagcctattggaaacaaaaaataa

DBGET integrated database retrieval system