KEGG   Clostridium botulinum F 230613: CBF_1346
Entry
CBF_1346          CDS       T01865                                 

Definition
(GenBank) xanthine dehydrogenase family protein, iron-sulfur binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
cbm  Clostridium botulinum F 230613
Pathway
cbm00230  Purine metabolism
cbm01100  Metabolic pathways
cbm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CBF_1346
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3 Fer2_4
Other DBs
NCBI-ProteinID: ADF99091
Position
1433387..1433860
AA seq 157 aa
MSLKRKIKFTVNDKKYEVEIDIRESLSEVLRSRLHLTGVKQGCLVGECGACTVLIDGVPT
DSCIYLAAWADGKTIKTIEGVQKNGELSEVQKAFIDEGAVQCGFCTPGLVLTTTALVESE
KNYTDDEIKREISGHLCRCTGYNKIFNATKKAILKRK
NT seq 474 nt   +upstreamnt  +downstreamnt
atgagtttaaaaagaaaaataaaatttacagttaatgataaaaagtatgaagtagaaata
gatattagagaatctttatcagaagtgttaagaagtagattacatttaacaggtgttaaa
caaggatgtcttgtaggagaatgtggagcatgtactgtcttaatagatggtgtcccaaca
gactcatgtatttacttagcggcttgggctgatggtaaaacaataaaaactattgagggg
gtacaaaaaaatggtgagctttcagaggttcaaaaagcctttatagatgaaggtgctgta
caatgtggattctgtacaccgggtttagttttaactacaacagctttagtagaaagtgaa
aaaaactatactgatgatgaaataaaaagagaaatatcaggtcatttatgtagatgtact
ggatataataaaatatttaatgctaccaaaaaagctattttaaaaagaaaatag

DBGET integrated database retrieval system