KEGG   Clostridium botulinum F 230613: CBF_2691Help
Entry
CBF_2691          CDS       T01865                                 

Definition
(GenBank) putative phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
cbm  Clostridium botulinum F 230613
Pathway
cbm00562  Inositol phosphate metabolism
cbm00564  Glycerophospholipid metabolism
cbm01100  Metabolic pathways
cbm01110  Biosynthesis of secondary metabolites
cbm02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CBF_2691
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CBF_2691
   00565 Ether lipid metabolism
    CBF_2691
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CBF_2691
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:cbm02042]
    CBF_2691
Enzymes [BR:cbm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     CBF_2691
Bacterial toxins [BR:cbm02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   CBF_2691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Zn_dep_PLPC
Motif
Other DBs
NCBI-ProteinID: ADG00331
Position
complement(2831664..2832383)
Genome map
AA seq 239 aa AA seqDB search
MIKKLEKTYGSALKGVFFAVNPLKKKMLKTNCTVHKYIDIKAVDLLKIEGYEKEYEFFKK
YIKHINNGVSWADQDFKSSNHFYHVSKGKGLYGFSDALTECRKYYKNAKGSFNNGNIEKS
LFYLGAACHLIQDATVPQHVNNKLLKSHRKFELWIISKLMTDYSFDAEEGIIKYNELQDF
IINNAIMANDTYLRSINIKNTDKRYAKIATTIIHEAQKTTAGFLLLFYEEMKVKNKILL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaacttgaaaaaacttatggaagtgctttaaaaggagtattttttgcagtg
aaccctttaaaaaagaaaatgcttaaaactaactgtactgtgcataaatatatagatatt
aaggcagtggatttacttaaaatagagggctatgaaaaagaatacgagttttttaaaaaa
tatataaagcatataaataacggggtttcttgggcggatcaggattttaaaagttctaat
catttttatcatgtaagcaaaggaaaaggattatatggcttttctgatgcattaacagag
tgcaggaagtactataaaaacgcaaaaggaagttttaataatggtaatatagaaaaaagt
ttattttatttaggtgctgcctgtcatttaatacaggatgctacagtgcctcaacatgta
aataacaaacttttaaaaagtcatagaaaatttgagctttggataataagtaagcttatg
acagattattcttttgatgcagaagaaggaataattaaatataatgaactacaagatttt
ataataaataatgctataatggctaacgacacctatttaaggagcataaatataaaaaat
acagacaaaagatatgctaaaatagctaccactataatacatgaagctcaaaagactact
gcaggatttttactattattttatgaagaaatgaaggtaaaaaataagattctcctttaa

DBGET integrated database retrieval system