KEGG   Clostridium botulinum F 230613: CBF_3158Help
Entry
CBF_3158          CDS       T01865                                 

Definition
(GenBank) putative N-acetylmuramoyl-L-alanine amidase
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
cbm  Clostridium botulinum F 230613
Pathway
cbm01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:cbm00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    CBF_3158
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cbm01011]
    CBF_3158
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cbm03036]
    CBF_3158
Enzymes [BR:cbm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     CBF_3158
Peptidoglycan biosynthesis and degradation proteins [BR:cbm01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   CBF_3158
Chromosome and associated proteins [BR:cbm03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    CBF_3158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_3 Y_Y_Y Glucosaminidase
Motif
Other DBs
NCBI-ProteinID: ADG00757
Position
complement(3340351..3343239)
Genome map
AA seq 962 aa AA seqDB search
MGKIFLLKERRGNIYMGEIENIAKKIPIILLISIIVAFVPSFKVHASSTTPIMGQHQLAQ
EQALNYFRSRNSEKSDQDIKDFISIIWQEANLEGIRADVVFMQIMKETNFLRFTGDVKEC
QNNFAGIGATGDGVAGAYFKDTRTGVRAVVQHLKAYCSTEGLKNPCVDPRFTYVQRGISP
YVEWLGIGENPNYPDKGWAADNNYGKSIVEMMNSAKYLANEGDSQGNITTSKATINNLEV
SLDGNKMTTNELEPGKSYNIKAYGNSSNGVLYEYWIKDLSINSWIKLKDYSTSTQVTWTP
NKPGKYLIGVHVKDKYSKEKLDNFKYVEYNVASLKKATISSLEVSLDGNNVVNNELQLGK
TYNIKAYGSSSNGVLYEYWIKDLSKNSWMKLRDYSTSTQVTWTSNKSGKYLLGVHVKDRY
SEERLDNFKYVEYNVASPKKATVNSLEVILDGNKVVTNELDPGKSYNIKVYGNSSNGVLY
EYWIKDLSINSWIKLKDYSTSTQVTWTPNKPGKYLIGVHVKDKYSKEKLDNFKYVDYNVT
SPKKANINSLEVSLDGTKVVNNELQAGEIYNIKAYGSSFNGVLYEYWIKDLSINSWIKLK
DYSTSTQVTWTPNKSGKYLIGVHVKDKYSTQKLDNFKYVEYNVKLSKKAVISNLEVSLNG
KIVTNNQLNSGKTYSIKTYAESLNGVLYEYWIKDLSSNSWIKLKDYSTSTQITWTPNKAG
KYLIGVHVKDKYSNERLDNHKYVEYSIQGDLIKTIVLDAGHGGKDSGAVSSKATGNVHEA
DIVQKITIKLGNLLKKAGYNVIYTRDKVDNYNYPSITQNLEDRINVANSIKADLFMSIHA
DSFDIPSANGYGAHYSSYRPNLDNSGVYKEGDVYYDRTPCDAALKSKVLSQLIVNEMSSL
GGSNRGIEDHNLYVTRNALMPSVLVETGFVSNDTEVRKLNSDSYQNQIAQKLYNAVTKLF
SM
NT seq 2889 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaatatttttactaaaagaaaggaggggaaatatatatatgggggaaatagaa
aatatagctaaaaagattccaataatacttttaatcagtattattgtagcctttgtacct
tcatttaaagtacatgctagtagtactacacctataatgggacaacatcagttagcacag
gaacaagcattaaattattttagatctagaaatagtgaaaagagtgaccaagacataaaa
gattttatctctataatttggcaggaagctaatttagaaggaataagagctgatgtagtt
tttatgcaaataatgaaagaaacaaattttttgagatttacaggagatgtaaaagaatgt
caaaataattttgcaggtattggtgctacaggtgatggtgtagcaggtgcttattttaaa
gatacaagaacaggagtaagagccgttgttcaacatctaaaagcctattgtagtactgag
ggattaaaaaatccttgtgtagatccacgatttacatatgttcaaagaggaataagtccc
tatgttgagtggctaggtataggggaaaatcctaattatccagataaaggatgggctgca
gataataattatggtaagagtatagttgaaatgatgaacagtgcaaagtatctggcaaat
gaaggtgattcacaaggaaatataactacttcaaaggctactattaataatttagaagta
agcttagatggaaataagatgacaaccaatgaattagaaccaggaaaatcatataacata
aaagcttatggaaatagttctaatggggtattatatgaatattggataaaagacttatca
attaattcatggataaagttaaaagattatagtacaagtactcaagttacatggacacca
aataagccagggaaatatttaataggggtacacgtaaaagataaatatagtaaagaaaaa
ttagataattttaagtatgtagaatataatgtagcatcccttaaaaaagctactattagc
agcttagaagtaagcttagatggaaataatgtagtgaataatgaattacaactaggtaag
acatataatataaaagcttatggcagtagctctaatggcgtattgtatgaatattggata
aaagacttatcaaagaattcatggatgaagttaagagattatagtacaagtactcaagtc
acatggacatcaaataagtcaggaaagtatctattaggagtacatgttaaagataggtat
agtgaagaaaggttagataactttaagtatgtagaatacaatgtagcatcacctaaaaag
gctactgttaatagcttagaagtaatcttagatggaaataaggtagtaactaatgaatta
gatccaggaaaatcatataacataaaagtttatggaaatagttctaatggagtattatat
gaatattggataaaagacttatcaattaattcatggataaagttaaaagattatagtaca
agtactcaagttacatggacaccaaataagccagggaaatatttaataggggtacacgta
aaagataaatatagtaaagaaaaattagataattttaaatatgtagattataatgtaaca
tcacctaaaaaggctaatatcaatagtttagaagtaagtctagatggaactaaagtagta
aataatgaactacaagcaggtgaaatatataatataaaagcttatggtagtagttttaat
ggagtattgtatgaatactggataaaagacttatcaattaattcatggataaagttaaaa
gattatagtacaagtactcaagttacatggacaccaaataaatcagggaaatatttgata
ggggtacacgtaaaagataaatatagtacacaaaaattagataattttaagtatgtagaa
tataatgtgaaactatcaaaaaaagcagttattagtaacttggaagtaagcctaaatgga
aagatagtaacaaacaaccaattaaattcaggaaaaacatatagtataaaaacttatgcg
gaaagtcttaatggagtattgtatgaatattggataaaagatttatccagtaattcatgg
ataaagctaaaagattatagtacaagtactcaaatcacatggacaccaaataaagcagga
aaatatctaataggagtgcatgtaaaagataaatatagtaatgaaagattagacaatcat
aaatatgtagaatatagcattcaaggtgatttaataaagactatagtcttagatgcaggc
catggaggtaaagattcgggagctgtatcttctaaagctacgggaaatgtacacgaagca
gatatagttcaaaaaattactatcaagttgggaaacctactaaaaaaagcaggatataat
gttatttatactagagataaggtagataattataattatccttcaataacacagaatttg
gaagatagaataaatgtagctaatagtataaaagctgatttgtttatgagtatacatgct
gattcttttgatataccatcagctaatggatatggtgctcactatagtagttatagacct
aatttagataattcaggagtatataaagagggtgatgtgtattatgatagaactccttgt
gatgcagcattaaaaagcaaagtgttatcacaacttatagtaaatgagatgtcttcctta
ggaggatcaaataggggtatagaggatcacaatttatatgttacaagaaatgccttaatg
ccttctgttcttgtagaaactggatttgtttctaatgatacagaagttaggaagttaaat
agtgattcttatcaaaatcaaatagctcaaaaactttacaatgcagtaacaaaattattt
agcatgtag

DBGET integrated database retrieval system