KEGG   Clostridium botulinum F 230613: CBF_3161Help
Entry
CBF_3161          CDS       T01865                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cbm  Clostridium botulinum F 230613
Pathway
cbm00040  Pentose and glucuronate interconversions
cbm00052  Galactose metabolism
cbm00500  Starch and sucrose metabolism
cbm00520  Amino sugar and nucleotide sugar metabolism
cbm01100  Metabolic pathways
cbm01130  Biosynthesis of antibiotics
Module
cbm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cbm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CBF_3161 (galU)
   00052 Galactose metabolism
    CBF_3161 (galU)
   00500 Starch and sucrose metabolism
    CBF_3161 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CBF_3161 (galU)
Enzymes [BR:cbm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CBF_3161 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ADG00760
Position
complement(3348549..3349445)
Genome map
AA seq 298 aa AA seqDB search
MKVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVKSGIEQILIITGRNK
RAIEDHFDKSVELEKELEEKGKAEMLSMVKDISNMAEIYYIRQKEPKGLGHAISCAKTFV
GNEPFAVMLGDDVVYSDKPCLEQLIKCYNEYQTTIVGVQEVPEEDVHKYGIVKGMFIEDR
VYKIKDLVEKPPKEEAPSNMAILGRYIISPAIFDILENTKPGKGGEIQLTDALKTLINKE
AMYAYNFEGRRYDVGDKLGFLQATVEYALRREKLNANFVKYLQQLKNNEEFTALFKTE
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaaaaaggccataattcctgcagcaggattgggaacaagatttttgcctgca
actaaagctcaacctaaagaaatgttacctatagttgataaaccaactatacaatatata
atagaggaagctgtaaaatccggtatagaacaaatattaataataactggaaggaataaa
agagctatagaagatcattttgataaatctgtagagttggaaaaggaattagaagaaaaa
ggcaaagctgaaatgctttctatggttaaagatatatctaatatggctgaaatatattat
ataagacaaaaagaacctaaaggattagggcatgctataagttgtgctaagacctttgtt
ggtaatgaaccctttgcggtaatgttaggggacgatgtagtttatagtgataaaccttgc
ttagagcagcttataaaatgctacaatgaatatcaaacaactatagtaggtgtacaagaa
gtaccagaagaagatgtacataaatatggtattgtgaaaggtatgtttatagaagataga
gtatataaaataaaagatttagtagaaaaaccacccaaagaagaagctccatctaatatg
gctatattagggagatatattataagtcctgctatatttgatattttagaaaatacaaaa
ccgggtaaaggtggagaaatacagcttacagatgcattgaaaacattgattaataaagag
gccatgtatgcatataattttgagggtagaagatatgatgttggagataaactaggattt
cttcaggctactgtagagtatgcactgagaagagaaaaattaaatgcaaatttcgtcaaa
tatctacaacaattgaaaaataatgaagaatttacagcgctatttaaaactgaataa

DBGET integrated database retrieval system