KEGG   Clostridium botulinum F 230613: CBF_3331Help
Entry
CBF_3331          CDS       T01865                                 

Definition
(GenBank) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbm  Clostridium botulinum F 230613
Pathway
cbm00071  Fatty acid degradation
cbm00280  Valine, leucine and isoleucine degradation
cbm00310  Lysine degradation
cbm00362  Benzoate degradation
cbm00380  Tryptophan metabolism
cbm00620  Pyruvate metabolism
cbm00630  Glyoxylate and dicarboxylate metabolism
cbm00640  Propanoate metabolism
cbm00650  Butanoate metabolism
cbm00900  Terpenoid backbone biosynthesis
cbm01100  Metabolic pathways
cbm01110  Biosynthesis of secondary metabolites
cbm01120  Microbial metabolism in diverse environments
cbm01130  Biosynthesis of antibiotics
cbm01200  Carbon metabolism
cbm01212  Fatty acid metabolism
cbm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CBF_3331
   00630 Glyoxylate and dicarboxylate metabolism
    CBF_3331
   00640 Propanoate metabolism
    CBF_3331
   00650 Butanoate metabolism
    CBF_3331
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CBF_3331
   00072 Synthesis and degradation of ketone bodies
    CBF_3331
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CBF_3331
   00310 Lysine degradation
    CBF_3331
   00380 Tryptophan metabolism
    CBF_3331
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CBF_3331
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CBF_3331
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CBF_3331
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbm04147]
    CBF_3331
Enzymes [BR:cbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CBF_3331
Exosome [BR:cbm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CBF_3331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ADG00915
Position
complement(3500511..3501689)
Genome map
AA seq 392 aa AA seqDB search
MKNVVIASAVRTPIGKFGGTLKSVSAIELGSIVIKEALKRANVKPEDVDEVIMGNVLQAG
LGQNSTRQSAVAAGIPVEVPSFTINKVCGSGLRAVSLATQLIKLGDDDIVVAGGTENMSA
APYLLEKARWGQRMGDGKIVDEMIRDGLWESFNDYHMGITAENIAEQWGITREEQDEFSA
KSQQKAEKAVKEGRFKEEIVPVVIKSRKGEVVFDTDEFPRFGATKESLSKLKPAFKKDGT
VTAGNASGINDGAAALVIMSEEKANELGIKPLAKIVAYGTSGVDPKIMGYGPFYATKKTL
EKANLKIADMDLIEANEAFAAQSLAVAKDLGFDMDKVNVNGGAIALGHPIGCSGARILTT
LLYEMEKRNSKHGLATLCIGGGMGTAIIVERY
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgttgttattgctagtgctgtaagaacacctataggaaaatttggaggaaca
ttaaaaagtgtttcagctatagaattaggaagtattgttattaaagaagctttaaaaaga
gctaatgtaaaaccagaagatgttgatgaggttataatgggtaatgtacttcaagcaggt
cttggtcaaaactcaacaagacaatctgcagtagcggcaggtataccagtagaagtacca
agctttacaataaataaggtttgtggttcaggacttagagcagtaagtttagcaactcaa
ttaataaaactcggagatgacgatatagtagtagcaggtggtacagaaaatatgtctgca
gctccatatcttttagaaaaagcaagatggggacagagaatgggcgatggaaaaattgta
gacgagatgataagagatggactatgggaatcttttaatgactatcatatgggaattacg
gctgaaaatatagcagagcaatggggaataacaagagaagagcaagacgaattttcagct
aaatcacaacaaaaagcagagaaagctgtaaaagaaggaagatttaaagaggaaatagta
ccagtagttattaaaagtagaaaaggcgaagtagtatttgatactgatgaatttcctaga
tttggtgctactaaagagagcctttctaaattaaaaccagcttttaaaaaagatggaaca
gttacagctggtaatgcttcaggtataaatgatggagcagctgctttagttatcatgagt
gaagaaaaggcaaatgaattaggaattaaacctttagctaaaatagttgcttatggtaca
agtggagtagatccaaagataatggggtatggaccattttatgcaactaaaaaaacttta
gaaaaagccaacctaaaaatagcagatatggatttaatagaagcaaatgaagcttttgcg
gctcaaagtttagcagtagctaaagatctaggttttgatatggataaagtaaatgtaaat
ggtggagctatagctttaggacatccaattggatgctcaggggctagaatattaactact
ttattatatgaaatggaaaaaagaaattcaaaacatggcttagctaccttatgtataggc
ggtggaatgggaacagctattattgttgaaagatattaa

DBGET integrated database retrieval system