KEGG   Clostridium botulinum BKT015925: CbC4_0573Help
Entry
CbC4_0573         CDS       T01475                                 

Gene name
tpiA
Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
cbn00010  Glycolysis / Gluconeogenesis
cbn00051  Fructose and mannose metabolism
cbn00562  Inositol phosphate metabolism
cbn01100  Metabolic pathways
cbn01110  Biosynthesis of secondary metabolites
cbn01120  Microbial metabolism in diverse environments
cbn01130  Biosynthesis of antibiotics
cbn01200  Carbon metabolism
cbn01230  Biosynthesis of amino acids
Module
cbn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cbn_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cbn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CbC4_0573 (tpiA)
   00051 Fructose and mannose metabolism
    CbC4_0573 (tpiA)
   00562 Inositol phosphate metabolism
    CbC4_0573 (tpiA)
Enzymes [BR:cbn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CbC4_0573 (tpiA)
Exosome [BR:cbn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CbC4_0573 (tpiA)
  Exosomal proteins of bladder cancer cells
   CbC4_0573 (tpiA)
  Exosomal proteins of melanoma cells
   CbC4_0573 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM AAA
Motif
Other DBs
NCBI-ProteinID: AEB75253
Position
615649..616401
Genome map
AA seq 250 aa AA seqDB search
MRKAIIAGNWKMNNTISQGVKLVEELKPLVADANCDVVVCPSTLCLDAIVKATEGTNIKV
GAQNMHFEESGAFTGETAPAMLEELGVKYVILGHSERRQYFGENDADLNKKMKKAFEHNL
TPILCIGETLEEREADVTEEVLAKQIKLDLAGLTKEQIEETVIAYEPIWAIGTGKTATSD
QAEETIAFVRKTVAGMFGAEAAEKMRIQYGGSVKPATIKEQMAKPNIDGGLIGGASLKAA
DFAGIVNFDK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcaattatagcaggaaactggaaaatgaacaatacaatttcacaaggagtt
aaacttgttgaagaattaaaaccattagtagcagatgcaaactgtgatgtagtagtttgt
ccatcaactttatgtttagatgcaatagtaaaagctactgaaggaactaatataaaagtt
ggagctcaaaacatgcactttgaagaaagtggagcatttacaggagaaactgcaccagct
atgcttgaagaattaggagtaaaatacgttatattaggacatagtgaaagaagacaatac
ttcggagaaaatgatgctgacttaaacaaaaaaatgaagaaagcatttgaacataattta
actccaatcctttgcataggagaaactttagaagaaagagaagcagatgttactgaagaa
gtacttgcaaaacaaatcaaacttgatttagcaggacttactaaagaacaaatcgaagaa
actgtaatagcttatgaaccaatctgggctattggaacaggaaaaactgctacatctgat
caagcagaagaaactatagctttcgtaagaaagacagttgcaggtatgtttggagctgaa
gctgctgaaaaaatgagaatccaatacggtggatctgttaaaccagcaactataaaagaa
caaatggcaaaaccaaacatagatggtggtcttataggtggagcttcacttaaagctgct
gattttgctggaatagtaaactttgataaataa

DBGET integrated database retrieval system