KEGG   Clostridium botulinum BKT015925: CbC4_0646Help
Entry
CbC4_0646         CDS       T01475                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
cbn00520  Amino sugar and nucleotide sugar metabolism
cbn01100  Metabolic pathways
cbn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CbC4_0646 (nagA)
Enzymes [BR:cbn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     CbC4_0646 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 Drf_GBD
Motif
Other DBs
NCBI-ProteinID: AEB75326
Position
complement(703650..704795)
Genome map
AA seq 381 aa AA seqDB search
MRCILNGTILTEDSLLKNKALIFDKTIIDIVDENSINKNDFSEIIDAKGNYISPGFIDIH
IHGSGGKDVMDGDFNSLQTISKVIASKGTTSFLPTTMTMSKEKIYNSLTCIKSCMNKNLG
GAKILGAHMEGPFINYKYKGAQNPDFILKPNFNFIKPFKDIIKIITLAPEEDKNFNFIKK
IVNSTDIILSIGHSNATYEETIEAINLGIHHVTHTFNGMPPFHHRTPGIIGALFNCNNIK
CEIIADTIHVHKGALKMLVNLKGKDNVILITDSMEAGCMHDGTWKLGGQKVIVKQNSARL
ESGSLAGSVLTLNTAIKNILDNTNLTLNEAVNLATLNPAKELKISNTKGSIDLNKDADLV
IFNKNLDIKCTIVEGNIVFKN
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagatgtatcttaaatggaactattttaaccgaagactcattgttaaaaaataaagcc
ttaatattcgataaaactataattgatatagttgatgaaaattcaattaataaaaatgat
ttttctgaaattattgatgcaaaaggaaattatatatctcctggttttatagatattcat
attcatggttctggtggaaaagatgtaatggatggagattttaattcattacaaaccata
agtaaagttatcgcaagtaaaggtacgacctctttcttgccaactactatgactatgtct
aaagaaaaaatatataattctttaacctgtataaaatcatgtatgaataaaaatttagga
ggggccaaaatattaggtgctcatatggaaggtccttttataaactataaatataagggg
gcccaaaatccagactttatactaaaacctaattttaattttataaaaccatttaaagat
ataataaaaataattacccttgctcctgaagaagataaaaatttcaattttataaaaaaa
atcgtaaatagtacagatataattttatctattggtcactcaaatgcaacatatgaagaa
actatagaagctataaatttaggtatacatcatgtaactcatacttttaatggtatgcca
ccctttcatcatagaactccaggaataattggtgcattatttaattgcaataatataaaa
tgtgaaattatagctgatactattcacgtccataaaggagccttaaaaatgttagtgaat
ttaaaaggcaaagataacgtaattcttataacagattctatggaagcaggttgcatgcac
gatggcacttggaaattgggtggtcaaaaagtaatagttaaacagaattctgctcgcctt
gaaagtggttctcttgctggtagcgttctaaccttaaatacagctataaaaaatattttg
gataacacaaatctaactttaaacgaagctgtaaatcttgcaactttaaatcctgctaaa
gaattaaaaatttctaatacaaaaggaagtattgatctcaataaagatgccgatttagta
attttcaataaaaatttagatataaaatgtaccattgtagagggaaacatagtatttaaa
aattaa

DBGET integrated database retrieval system