KEGG   Clostridium botulinum BKT015925: CbC4_1347Help
Entry
CbC4_1347         CDS       T01475                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
cbn00071  Fatty acid degradation
cbn00280  Valine, leucine and isoleucine degradation
cbn00310  Lysine degradation
cbn00362  Benzoate degradation
cbn00620  Pyruvate metabolism
cbn00630  Glyoxylate and dicarboxylate metabolism
cbn00640  Propanoate metabolism
cbn00650  Butanoate metabolism
cbn00900  Terpenoid backbone biosynthesis
cbn01100  Metabolic pathways
cbn01110  Biosynthesis of secondary metabolites
cbn01120  Microbial metabolism in diverse environments
cbn01130  Biosynthesis of antibiotics
cbn01200  Carbon metabolism
cbn01212  Fatty acid metabolism
cbn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cbn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CbC4_1347
   00630 Glyoxylate and dicarboxylate metabolism
    CbC4_1347
   00640 Propanoate metabolism
    CbC4_1347
   00650 Butanoate metabolism
    CbC4_1347
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CbC4_1347
   00072 Synthesis and degradation of ketone bodies
    CbC4_1347
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CbC4_1347
   00310 Lysine degradation
    CbC4_1347
   00380 Tryptophan metabolism
    CbC4_1347
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CbC4_1347
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CbC4_1347
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CbC4_1347
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cbn04147]
    CbC4_1347
Enzymes [BR:cbn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CbC4_1347
Exosome [BR:cbn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CbC4_1347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEB76026
Position
complement(1438065..1439228)
Genome map
AA seq 387 aa AA seqDB search
MSNNVYIVGGLRTPIGKTNGALKDILPEDLSAHLIKNIIDKYNIEPQYIEEVMLGNSVGP
GGNLARLSLLQAGLPFSVVGTTIDFQCGSSLKAINMAASLIKSKERDLILVGGVESTSLA
PNKQYNKRDYRYKGKDIFYKRAQFAPLTIGDPDMIEGAENTAKFFDIKRGDMDELAVESH
LRALKANKEGKLKSIICNIKIGNTIISEDESIRKKISLNLVKRARPILHKEGSLTAANTC
LTHDGGAILLMASEKAIKKYNLKPMAIWRGEASIGLDPNLSPLGATLAIENLIGKYNLNI
ENIDLIEINEAFSVKILAFLKKFKYPKEKINIYGGALAYGHPYGASGAIIMLHLLEGLKN
EGGNLGIASLGVAGGLGIATLIERYHC
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgagcaataatgtatacatagtaggaggtcttagaactcctataggcaagactaatgga
gctttaaaagatatattacctgaggatttgagtgcacatttgattaaaaatattattgat
aaatataatattgaaccacaatatatagaagaagttatgctaggaaattctgttggcccc
ggaggaaatttggctagactaagtttgcttcaagcaggattgcctttttcagtagttggt
acaacaatagattttcaatgcggttctagtttaaaagcaataaacatggcagctagtctg
ataaaatctaaagagagagatttaatattagtagggggagtagaaagcactagtttagca
cctaacaaacaatataataagagagattatagatataaaggaaaagatattttttataaa
agggcacaatttgcccctcttactataggtgacccagacatgatagaaggagcagaaaat
acagctaaattttttgatataaaaagaggagacatggatgaattagcagtagaaagtcat
ttaagagctttaaaagctaataaagaaggtaaacttaaatctataatatgtaatataaaa
ataggaaataccataatatcagaagatgaaagtatacgaaaaaagatttctttaaacctt
gtaaaaagagcaagaccaattttacataaggagggatctttaacagcagctaatacttgc
ctgactcatgatggaggggctattttacttatggcatcagaaaaagctataaaaaagtat
aacttaaagccaatggctatttggagaggtgaggcttcaataggattagatcctaatcta
tcacctttaggggctacattagctatagagaacttaattggaaaatataatttaaatata
gaaaatatagatttaattgagataaatgaagccttttctgtgaagatattagccttttta
aagaagtttaaatatcctaaggagaagataaatatttatggaggagctttagcttatgga
cacccttatggagcatctggagctattattatgcttcatcttttagaaggtcttaaaaat
gagggtggtaaccttggaattgcatccttaggagtagcaggagggctaggtatagctacg
ctaatagaaagatatcattgctag

DBGET integrated database retrieval system