KEGG   Clostridium botulinum BKT015925: CbC4_2261Help
Entry
CbC4_2261         CDS       T01475                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cbn  Clostridium botulinum BKT015925
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1779
Motif
Other DBs
NCBI-ProteinID: AEB76926
Position
complement(2461891..2462628)
Genome map
AA seq 245 aa AA seqDB search
MYVHNLKGKRGGIYMKNIKKGVVFFITVVSIFLNYKITYAYKNIDYFEKFINTTGSKVIE
YGVNTKFETTINGQELFSCFKDRIPIIGYLKLNTYENKGNYHMEFKNSNIKGYILIQSLK
EKSYVTINIIKTDNTNKLSKLQSQVRELKEGLSKKEGIYYQYLKAKLPDNDLSKVNNNLI
SLLKNTGAINVDSVEINDGFSTCAYTTQYEPKRNNGKLMDLNYALSNYSSGAYITIATPE
IITTY
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
ttgtatgtccataatttaaaaggaaaacggggagggatatatatgaaaaatataaaaaag
ggcgtagtgttttttatcactgtggtttctatatttttaaattataaaataacatatgca
tataaaaatatagattacttcgagaaatttataaatacgacaggaagtaaagtgatagaa
tacggagttaatactaagtttgaaactacaataaatggacaagaattatttagttgtttt
aaagataggattcccattataggatatttaaaattgaatacttatgaaaataaaggaaat
taccatatggagtttaaaaattctaatataaaaggttatatactaatacaaagcttaaaa
gaaaaatcctatgtaaccataaatatcataaaaacagataataccaataaattaagcaaa
ttacagagtcaagttagagagttaaaagaaggtttatctaaaaaagaaggtatatattat
caatatttaaaagccaagttacctgataatgatttatcaaaagtaaataataacttgata
tctttattaaaaaatacaggtgcgataaatgttgattcggtggaaattaatgatggattt
agcacttgtgcatatacgactcagtatgaaccaaagaggaataatggtaaattaatggat
ttaaattatgcattaagtaattactcctcgggagcatatataactatagcaactcctgaa
ataattacaacttactag

DBGET integrated database retrieval system