KEGG   Clostridium botulinum BKT015925: CbC4_2264Help
Entry
CbC4_2264         CDS       T01475                                 

Gene name
atpG
Definition
(GenBank) ATP synthase F1, gamma subunit
  KO
K02115  F-type H+-transporting ATPase subunit gamma
Organism
cbn  Clostridium botulinum BKT015925
Pathway
cbn00190  Oxidative phosphorylation
cbn01100  Metabolic pathways
Module
cbn_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:cbn00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CbC4_2264 (atpG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:cbn00194]
    CbC4_2264 (atpG)
Photosynthesis proteins [BR:cbn00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   CbC4_2264 (atpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt EIF4E-T
Motif
Other DBs
NCBI-ProteinID: AEB76929
Position
complement(2464558..2465415)
Genome map
AA seq 285 aa AA seqDB search
MAGAGLIAIKRRIKSINNTKKITKAIGLVATSKLRKARQKLELNNTYYSSVSDIMNGILS
DSNLEKGIYFKNNGNNKKLYIVITSDSGLCGGFNGNVISKTLQEISGNRENSLLITVGKK
GRTYLKKYKIESIAEYVDVPEIPTLKEVKAILDKALMLYLNGEVGEINVVYTHFVSSVKQ
ESKVKKLLPITSESNEKDINTFMEFEPDKSVVLEGISELYLKQTLLNLLLNSKTCEESSR
MTAMDGATQNANDLLDKLNLKYNRIRQSSITQEISEIVGGAQAQK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcgcagggttaattgctataaaaagaagaattaaatccataaataacactaaa
aagataacaaaagctataggacttgttgccacctctaaactaagaaaagctagacaaaaa
ttagaattaaataatacttattatagttccgttagtgacattatgaatggaatattatca
gattctaatttagaaaaaggaatatatttcaaaaataacggaaataataagaaattatat
atagtaattacttcggactcaggtctttgtggaggatttaatggtaatgtaatttcgaag
actctacaagaaatatcaggtaatagagaaaatagtcttcttattactgtcggaaaaaaa
ggaagaacttatcttaaaaaatataaaatagaatctattgctgaatatgtagatgtacct
gaaattcctactttaaaagaagttaaagccattttagataaagctcttatgctttatcta
aatggtgaagtaggagaaataaatgtagtatatactcattttgtttcttctgttaaacag
gaatctaaggtaaaaaaactattaccaataacttcagaaagtaatgaaaaggatataaat
acttttatggaatttgagccagataaaagtgtggttttagaaggtatttcagagttatat
ttaaagcaaactttactaaatttattattgaattctaagacttgcgaagaatcgtcaaga
atgacggctatggatggagctactcagaatgcaaatgatttattagataagcttaactta
aaatataatagaataagacaaagtagtataactcaagaaatatcagaaatagtaggtgga
gcacaagctcaaaagtaa

DBGET integrated database retrieval system