KEGG   Clostridium botulinum BKT015925: CbC4_2269Help
Entry
CbC4_2269         CDS       T01475                                 

Definition
(GenBank) ATP synthase F0, A subunit
  KO
K02108  F-type H+-transporting ATPase subunit a
Organism
cbn  Clostridium botulinum BKT015925
Pathway
cbn00190  Oxidative phosphorylation
cbn01100  Metabolic pathways
Module
cbn_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:cbn00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CbC4_2269
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:cbn00194]
    CbC4_2269
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cbn03110]
    CbC4_2269
Photosynthesis proteins [BR:cbn00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   CbC4_2269
Chaperones and folding catalysts [BR:cbn03110]
 Other chaperones and cochaperones
  PapD
   CbC4_2269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_A NIPSNAP
Motif
Other DBs
NCBI-ProteinID: AEB76934
Position
complement(2468346..2468915)
Genome map
AA seq 189 aa AA seqDB search
MVTRKLRKVPGKRQTVVEMFVEGIKNVVKNIMGEGAVVFAPYVGTLVIFLLLMNLAGLVG
IEPPTKDFSVTCGVAAISFVVIQAYAIKKQGLIGYFKGYANPIWVLFPINIMERIMLPVS
LSLRLFGNITAAVVIMDLVYKGLSHLPFGIAQLGLPIPLHFYFDVFDGGLQMIIFTMLTM
INIKIIAEH
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggtaactagaaagctaaggaaggtacctggtaaaaggcaaacagtagtagaaatgttt
gttgaaggtataaaaaatgtagtaaaaaacattatgggagaaggcgctgtagtgtttgca
ccatatgtgggtacattagttatatttttactattgatgaatttagctggattagtggga
atagagcccccaacaaaagattttagcgtaacttgtggagttgcagctataagttttgta
gtaatacaagcttacgcgattaaaaaacaaggcttaattggttactttaaaggatatgca
aatcctatatgggtgttattcccaataaatataatggaaagaataatgcttcctgtatca
ttgagtcttagattgtttggaaatataacagcagccgtagttataatggacttggtttat
aagggactttctcatctaccatttggaattgctcagctgggattacctattccactgcac
ttttactttgatgttttcgatggtgggttacagatgattatatttactatgcttacaatg
ataaatataaagataatagcagaacactaa

DBGET integrated database retrieval system