KEGG   Clostridium botulinum BKT015925: CbC4_2280Help
Entry
CbC4_2280         CDS       T01475                                 

Definition
(GenBank) Predicted membrane protein
Organism
cbn  Clostridium botulinum BKT015925
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEB76945
Position
complement(2477626..2478030)
Genome map
AA seq 134 aa AA seqDB search
MFIKSDKEYLNYKIDTKIRVVNGIFGGRYVVPCDKVEMVHTLKDGGDLRIIIVLRSKFRN
SKIKLVGPYFLKRQKWIKKYYEELKEKSIFNQCYYFVIYKGGYNKYQLLDSIYRNCVQAH
FTDDCIKRIKEYRE
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgtttattaaatctgataaagaatatttaaattataaaatagatacaaaaataagagtg
gttaacggaatttttggaggacgatatgtggtgccttgtgataaggtggagatggtacat
acgttaaaagatggtggagatttaagaatcataatagtattaagatcaaaatttagaaac
tcaaaaataaagttggttggaccttattttttaaaaagacaaaaatggattaaaaaatac
tatgaagagttaaaggaaaaaagtatatttaatcaatgttattattttgttatatataag
ggtgggtacaataagtatcaattattagattccatatatagaaattgtgtacaagcccat
tttacggatgactgtataaaaagaataaaagaatatagagagtaa

DBGET integrated database retrieval system