KEGG   Clostridium botulinum BKT015925: CbC4_2281Help
Entry
CbC4_2281         CDS       T01475                                 

Gene name
prfA
Definition
(GenBank) peptide chain release factor 1
  KO
K02835  peptide chain release factor 1
Organism
cbn  Clostridium botulinum BKT015925
Brite
KEGG Orthology (KO) [BR:cbn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cbn03012]
    CbC4_2281 (prfA)
Translation factors [BR:cbn03012]
 Eukaryotic Type
  Release factors
   CbC4_2281 (prfA)
 Prokaryotic Type
   CbC4_2281 (prfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCRF RF-1
Motif
Other DBs
NCBI-ProteinID: AEB76946
Position
complement(2478221..2479294)
Genome map
AA seq 357 aa AA seqDB search
MLDKLDFTENKYEELSIKISDPSVMANQNEWRKLCKEHAELETIVTKYREYKNNKEELVA
NKELLSEENDRDMKEMIQEEIKTLEESIVSDEEELKILLLPKDPNDDKNVFIEIRAGAGG
DEAALFAANLFRMYTRYAERHGWKTELMSANETDIGGFKEVVFMLRGDSAYSKMKFESGV
HRVQRVPDTESSGRIHTSTATVAVLPEVDDVDIQIDPNDIRIDVFRASGHGGQCVNTTDS
AVRMTHIPTGIVVSCQDEKSQLKNKEKALKVLKARLYEKAEAERAASISADRKSQVGTGD
RSERIRTYNYPQGRVTEHRIGVTLYKLDAFLDGDMEEIIDALITAEQAEKMKAMGNN
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgttagataaattggattttacagaaaataagtacgaagaattatcgataaaaattagt
gacccatcagtaatggctaatcaaaatgaatggagaaaactatgtaaagagcatgcggag
cttgaaactatagttacaaagtatagagaatataaaaataataaagaagaattagtagct
aataaagaattactttcagaagaaaatgatagagatatgaaagaaatgattcaagaagag
ataaaaactctcgaagaaagtatagtaagtgatgaagaagagttaaaaatattacttctt
cctaaagatcctaatgatgataaaaacgtatttatcgaaataagagctggtgctggtgga
gatgaagcagcattatttgcagctaacttatttagaatgtatacaagatatgctgaaaga
catggttggaagactgaacttatgagtgccaatgaaacagatattggtggatttaaggaa
gttgtatttatgttaagaggagattcagcatatagtaaaatgaaatttgaaagtggagtt
catagagtgcaaagagttccagatactgaatcaagtggaagaatacatacgtctacagct
actgtagcagttttaccagaagtggatgacgttgatatacaaatagatcctaatgatatt
agaattgatgtatttagagcatcaggacacggtggacaatgtgtaaatactacggactca
gcagtaagaatgacacatataccaacaggtatagttgtatcatgtcaagatgaaaagtca
cagcttaaaaataaagaaaaagctctaaaggtattaaaagctagattatacgaaaaggca
gaagcagaaagagctgctagtatatcagcagacagaaagagtcaagttggtactggagat
agaagtgaaagaataagaacttacaattatccacaaggaagagttacagagcatagaata
ggtgttaccttatataaattagatgcgttccttgatggagatatggaagaaattatagat
gcattaataacagcagaacaagctgaaaaaatgaaagcaatgggaaataattaa

DBGET integrated database retrieval system