KEGG   Clostridium botulinum BKT015925: CbC4_2285Help
Entry
CbC4_2285         CDS       T01475                                 

Definition
(GenBank) ribosomal protein L31
  KO
K02909  large subunit ribosomal protein L31
Organism
cbn  Clostridium botulinum BKT015925
Pathway
cbn03010  Ribosome
Module
cbn_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:cbn00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CbC4_2285
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cbn03011]
    CbC4_2285
Ribosome [BR:cbn03011]
 Ribosomal Proteins
  Bacteria
   Large subunit
    CbC4_2285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L31 DUF3039 zf-TFIIB
Motif
Other DBs
NCBI-ProteinID: AEB76950
Position
2482092..2482301
Genome map
AA seq 69 aa AA seqDB search
MKEGLHPEYHHDAVVKCACGNTFTTGSTKSELKVDVCSKCHPFYTGKQKILDTGGRIEKF
MKKYNLENK
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaggtttacacccagaatatcatcatgatgcagtagttaaatgtgcatgtgga
aatactttcactactggatcaactaaatctgaacttaaagtggatgtttgctctaaatgt
catcctttctatactggaaagcaaaagatattagatacaggcggaagaattgaaaagttc
atgaagaaatacaacttagaaaacaaatag

DBGET integrated database retrieval system