KEGG   Clostridium botulinum BKT015925: CbC4_2290Help
Entry
CbC4_2290         CDS       T01475                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cbn  Clostridium botulinum BKT015925
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NFACT-R_2 ThiI tRNA_Me_trans QueC PSCyt3
Motif
Other DBs
NCBI-ProteinID: AEB76955
Position
complement(2487063..2488046)
Genome map
AA seq 327 aa AA seqDB search
MTKALALISGGLDSILAAKLIKDQGIEVIGICFKSYFFGPDNAKRMTKQIDIPLEVVDFS
KEHFDMTKDPKHGHGKNMNPCIDCHAMMMRYAGELLEKFNADFIITGEVLNQRPMSQNKS
SLNVVKKESGFGDKILRPLCAKVLPPTEMELNGLVDREKLMGITGRGRKVQMELAEKWGI
KDYPSPAGGCKLTEPNFSIRLRELVEHKEEISEEDIELLRFGRHFRVSKDAKIISTRTGA
EAKEIKKYITENDIAFLVKDFGGSMVIIVGNPTEEDIVFAAKVTGRYSKGKDEEKLKVIY
GNYSKPYDCSIEVKPATDDELKEYMIG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagcgttagcacttatatcaggaggattagatagtattttagctgcaaaatta
attaaagatcaagggatagaagttataggaatatgttttaaatcatacttctttggacct
gataatgctaaaaggatgactaaacaaatagatatacctttagaagttgttgatttttct
aaagaacattttgatatgacaaaggatcctaaacatggacatggtaaaaatatgaatcca
tgtatagattgccatgctatgatgatgagatatgcaggagaacttctagaaaaatttaat
gctgattttattataacaggagaagttctaaatcaaagaccaatgtctcaaaataaatct
tcattaaatgtagtaaaaaaagaatcgggttttggagataaaatattaagacctctatgt
gcaaaagtgttaccacctacagaaatggagcttaatggacttgttgatagagaaaagctt
atgggtataacaggaagaggaagaaaggttcaaatggagcttgcagaaaagtggggtata
aaagattatccatctccagcaggcggatgcaaattaacagaacctaatttctctataaga
cttagagaacttgtagagcataaagaagaaatatctgaagaagatattgaattattgaga
tttggaagacactttagagtttcaaaagatgctaaaataatatctactagaactggagca
gaagctaaggaaattaaaaaatatattacagaaaatgatatagcatttttagttaaagat
tttggtggttccatggttataattgtaggaaatcctacagaagaagatatagtatttgct
gcaaaggtaactggaagatattcaaagggaaaagatgaagaaaaattaaaagttatatat
ggcaattactctaaaccatatgattgttctattgaagttaaacctgcaacggatgatgaa
ttaaaggaatatatgataggctaa

DBGET integrated database retrieval system