KEGG   Clostridium botulinum BKT015925: CbC4_2301Help
Entry
CbC4_2301         CDS       T01475                                 

Definition
(GenBank) sporulation peptidase YabG
  KO
K06436  spore coat assemly protein
Organism
cbn  Clostridium botulinum BKT015925
Brite
KEGG Orthology (KO) [BR:cbn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    CbC4_2301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_U57
Motif
Other DBs
NCBI-ProteinID: AEB76966
Position
complement(2498731..2499627)
Genome map
AA seq 298 aa AA seqDB search
MKIGDIVVRKSYGKDITFKIIDIRNNDEDEVYVLKGINMRIIADSPIDDLEFATEDIIMK
KEVTFNKKVNSRIRNILIQRNAEKKYRSPEEEKRGKNKTVKNSKKSESSMLFGRPGRVLH
IDGDPEYLDVCLKTYKQLNVESVGYVISEREQPKQVPKLVSEIRPDIVVLTGHDAIIKGA
KEYTDLNNYKNSKYFVQTVSELRTYEPNYDDLVIFAGACQSCYEAILDAGANFASSPNRV
LIHCLDPVFICEKIAYTNVGKVVSIHDVVYNTITGVDGVGGLQTRGKYREGFPKSKYS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaattggagacatagtagtaagaaaatcttatggaaaagatattacgtttaaaata
atagatataagaaataatgatgaagatgaggtgtatgtgcttaaggggataaatatgagg
ataatagcagattcaccaatagatgatttagaatttgcaacagaagatattataatgaaa
aaagaagttacatttaataagaaggtaaatagtcgtattagaaatatacttatacaaaga
aatgcagaaaaaaagtatagatcccctgaagaagaaaaaaggggaaaaaataaaacagtt
aagaactcaaaaaaaagtgaatctagtatgctctttggaagaccaggaagagtgctgcac
atagatggagatccagaatatctggacgtttgtttaaagacttataagcaactaaatgtt
gagtcagtgggatatgttatttcagaaagagagcaaccaaagcaagtgcctaaacttgtt
tctgaaataagaccagatattgtagttttaacaggacatgatgctattataaagggagcc
aaggaatatacagatcttaataattataaaaattctaagtattttgtacaaactgtttca
gagcttagaacatatgagcctaattatgatgatttagttatatttgcaggggcatgtcaa
tcttgttacgaagctatattagatgcaggtgctaattttgcaagttcacctaatagggtg
ttgattcattgtttagatcctgtatttatatgtgaaaaaatagcttataccaatgttgga
aaagtagtatctattcatgatgttgtgtataataccataactggagtcgacggggtagga
ggtttacaaaccagaggaaaatatagagaaggatttcccaaatctaaatattcttaa

DBGET integrated database retrieval system