KEGG   Clostridium botulinum BKT015925: CbC4_2303Help
Entry
CbC4_2303         CDS       T01475                                 

Definition
(GenBank) glycosyl transferase, group 1
Organism
cbn  Clostridium botulinum BKT015925
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_1_2 Glycogen_syn Glyco_transf_20 Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: AEB76968
Position
2500998..2502119
Genome map
AA seq 373 aa AA seqDB search
MKIGIDARAAKWYRGTGIGTYTYQLVNSLNKIDDLNQYLIFMPQSSTYDIKFKNNYKIKN
ITKDMKGEFWDEVNIPNILKNQDIDLYHVPQNGVGLPKDKTSPFVITLHDIIPYKMPETV
GPTYLEIFKKEMPNIISRCDGILTVSNYSKQDIIDAFNYPEEKIFVTHLANEDIYFPRDK
VKCKNFISKNYGINDDYILYVGGFSPRKNIIGLIEAFSKFKNNNLKLIIVGKQGKSYALY
KNTAEKLHISDKVIFPGFIPLEHMPIFYNACKLFVYPSLYEGFGLPPIEAMACGAPIITS
NLTSLPEVVGNAGLLINPYNIDELHQAMDKVLQDHILRNSLVKKSLTRSSKFSWTKTAKD
TLTAFQTIAGYKK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataggaattgacgctcgagcagcaaaatggtatagaggaaccggtattggcacc
tatacttatcaacttgttaactccttaaataaaatagatgatttaaatcaatacttaatt
tttatgcctcaaagtagtacttatgatataaaatttaaaaataattataaaataaaaaac
attactaaagacatgaaaggtgaattttgggatgaagtaaacataccaaatattttaaaa
aatcaagatatagatttatatcatgtacctcaaaatggagttggtcttcctaaagataaa
acttcaccttttgtaataactttacatgatataattccttataaaatgccagaaacagtc
ggtccaacttatcttgaaattttcaaaaaagagatgccaaatataatttcaagatgtgac
ggcatactaactgtatctaattattcaaaacaagatataatagatgcctttaattatcct
gaagaaaaaattttcgtaacacatcttgccaatgaggatatatattttcctagggataag
gttaaatgtaaaaatttcattagtaaaaattatggtataaatgatgactatatattatat
gtaggtggttttagtcctagaaaaaatatcatcggattaatagaagcttttagtaaattt
aaaaataataacttaaaattaattatagtaggtaaacaaggtaaatcatatgccctttat
aaaaacaccgctgaaaaactccatatttctgataaggttatatttcctggatttatacca
ttagaacatatgcctatattttataatgcatgtaaactttttgtatatccatctctttat
gaaggatttggattacctccaattgaagccatggcctgtggagctcctataattacttca
aatctaacatcccttcctgaagttgtaggaaatgcaggtcttttaataaatccctataat
atcgatgaactccaccaagctatggacaaagttttacaagatcatatcttaagaaactcg
ttagtgaaaaaatctttaacacgaagttcaaaattcagctggactaaaactgctaaagat
actctaacggcatttcaaactattgcaggatataaaaagtga

DBGET integrated database retrieval system