KEGG   Clostridium botulinum BKT015925: CbC4_2307Help
Entry
CbC4_2307         CDS       T01475                                 

Gene name
cobK
Definition
(GenBank) precorrin-6x reductase
  KO
K05895  precorrin-6A/cobalt-precorrin-6A reductase [EC:1.3.1.54 1.3.1.106]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
cbn00860  Porphyrin and chlorophyll metabolism
cbn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CbC4_2307 (cobK)
Enzymes [BR:cbn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.54  precorrin-6A reductase
     CbC4_2307 (cobK)
    1.3.1.106  cobalt-precorrin-6A reductase
     CbC4_2307 (cobK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiJ
Motif
Other DBs
NCBI-ProteinID: AEB76972
Position
complement(2504399..2505178)
Genome map
AA seq 259 aa AA seqDB search
MIGVVVGTSEGKEILSLLNEFTEDIFVSTATKYGGELLENYKYKILNTHPLDIEGFKKII
TDNSINIFIDASHPYAIEVSKNIIEACKCSGIIYFRYERPSIIEEFKNYKNIIRVKDYKE
LKEKLKNINGTILDTTGSKNIQKIIDMNLNSRIVHRVLPSSSVIKKCIDLGVKIENLIAI
KGPISYELNKAFIKEYNAEVLIMKDSGTAGGTYEKAKAIMDMNINGFIIERENIEYKNKF
TSIEELIDKVKGENNEHFK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgataggagtagtagttggaactagtgaaggaaaagaaattttatcacttttaaatgaa
tttacagaagatatttttgtatcaactgctacaaaatatggaggagaactattagaaaac
tataaatataaaatacttaatacacatccattagatatagaaggatttaagaaaatcata
acagataatagtataaatatttttatagatgcatctcatccgtatgccatagaggttagt
aaaaatattatagaagcgtgtaaatgtagtggaattatatattttagatatgaacgacct
tcaattatagaagagtttaaaaactataaaaatataataagggtcaaagactataaggaa
ctaaaagaaaagcttaaaaatattaatggaactattctagatactacgggaagcaaaaat
atacaaaagattattgatatgaatttaaatagtagaatagtacatagggtacttccaagt
agttcagttataaaaaaatgtattgatttaggagttaaaatagagaatttaatagcaata
aagggacccataagttatgaacttaataaggcttttataaaagaatacaacgcagaagtt
cttataatgaaagatagtgggactgctggtggaacatatgaaaaggctaaggccattatg
gatatgaatataaatgggttcataattgaaagagaaaatatagagtataaaaataaattc
actagcatagaggaattaattgataaagttaaaggagaaaataatgaacactttaaataa

DBGET integrated database retrieval system