KEGG   Clostridium botulinum BKT015925: CbC4_2321Help
Entry
CbC4_2321         CDS       T01475                                 

Definition
(GenBank) mannosyltransferase, putative
Organism
cbn  Clostridium botulinum BKT015925
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_1_2 Glyco_transf_20 Glycogen_syn
Motif
Other DBs
NCBI-ProteinID: AEB76986
Position
2516229..2517341
Genome map
AA seq 370 aa AA seqDB search
MKIAIDARGINWYRGTGIGTYTENVVKNLINIYDDTYFHLYWSEQNYEYFKKKNTELILT
SKKHPRFFEQNYFYNDLNRNEIDIYHVPQNGIGIDINIKCKKVITVHDLIPYIMPETVGK
GYLLKFLKEIPSIIQNADGILTVSEYSKKDILKFFPIDPNRIFVTPLAADKIYKPLEKGI
CKSLLKEKYNINNPFILYLGGFSARKNVSALINSFLKVHSSLHTDYNLVIVGAQKDLGEY
LSNKYSNLRSKIIFTGFIPQEELPIFYNSCDVFVYPSLYEGFGLPPLEAMSCGTPVITSN
TTSIPEVVGDSGLLINPYDEDELTTCLEKLLNNESLRKSLSIKSLKQSSKFSWYKTATKT
FESYKTIYEL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagccattgatgctagaggtatcaattggtatagaggcactggaattggtact
tatactgagaatgttgtaaaaaatctaataaatatatatgatgatacttattttcatctt
tattggtcagaacaaaattatgaatattttaaaaagaagaatacagaattaatccttact
tcaaaaaaacatcctcgtttttttgaacaaaattacttttataacgatttaaatagaaat
gaaattgacatatatcacgtacctcaaaatggaattggaattgatataaatataaaatgt
aaaaaggtgattacagtacatgatttaattccgtatattatgccagaaacagttggcaaa
ggctacttacttaaatttttaaaagaaattccaagtataatacaaaatgctgatggaata
ctcacggtttctgaatactcaaaaaaagatatattaaaatttttccctatagatcctaat
agaatttttgtaaccccccttgcagcagataaaatatataaacctcttgaaaagggaata
tgtaagtcattacttaaagaaaaatataatataaataatccatttatattatatttagga
ggatttagtgcacgaaaaaatgtatctgcactaataaactccttcttaaaagtacattct
agtcttcacacagattataatcttgttatagtcggtgcacaaaaagatttaggtgaatat
ttaagtaacaaatattcaaatttacgttctaagataatatttacaggttttatcccccaa
gaagaattacctattttctataattcatgtgacgtctttgtatatccatctctttacgag
ggatttggcttacctccacttgaagctatgagttgcggaactcctgtaatcacttctaat
acaacctcaattcctgaagttgttggtgatagtggtttattaatcaatccttatgacgaa
gatgaattaactacttgtttagaaaaattactgaataatgaatctcttagaaagtctctt
agtataaaaagtttaaaacaatcatctaaattttcttggtataaaacagctactaaaacc
tttgaatcttataaaacaatatatgagttataa

DBGET integrated database retrieval system