KEGG   Clostridium botulinum BKT015925: CbC4_2327Help
Entry
CbC4_2327         CDS       T01475                                 

Definition
(GenBank) putative hypothetical protein
Organism
cbn  Clostridium botulinum BKT015925
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEB76992
Position
2523541..2523732
Genome map
AA seq 63 aa AA seqDB search
MILAILFTIIENLYQNSIFYKILLKLILHDNYYYFNTIFSQCIRFFIHLSTFFLYCRMFV
LHK
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atgattctcgctattttatttacaataatagaaaatttatatcaaaattctatattttat
aaaatactattaaaattaatattacatgataattattattatttcaatactattttttca
caatgtatacgtttttttatacatttatctacattttttttatattgtagaatgtttgtc
ttacataaatag

DBGET integrated database retrieval system