KEGG   Clostridium botulinum BKT015925: CbC4_2329Help
Entry
CbC4_2329         CDS       T01475                                 

Definition
(GenBank) 5'-nucleotidase, lipoprotein e(P4) family
Organism
cbn  Clostridium botulinum BKT015925
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acid_phosphat_B LysM Hydrolase_6 Hydrolase
Motif
Other DBs
NCBI-ProteinID: AEB76994
Position
2526683..2527699
Genome map
AA seq 338 aa AA seqDB search
MSLRKNSFLISLALTSSIAFSSVTAFASTGNTYTVKAGDTLRKISTKYHTSWKHIAKLNN
IKNPYIIFPGQILKLQENISQPEPSLKKTSVTQKDLNEELVMAELWMQTSAEYRGLCYQA
YNNARSIIKDKVSTFKKGDKPLAIITDCDETVIENSIYDAGFIGHNDSHNPDNWPKWVNA
SAGNAMPGAKQFLDYANSKGVEIFYVTGRDEKNSLDGTMKNLKKLNFPCVDKYHMRLKTD
TGNKEPRMKEIEKKYNVIIYMGDDAGDFPIGSYHKDVNARNSLLDKNSDKFGTKFIILPN
PSYGHWESSLHKNYWQLTPEQKDSLRKKFIKTWRCDNK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaagaaaaaatagttttttaatatctttagcattaacttcttctatagcattt
tcatcagtaaccgcttttgcatctactggaaacacctatactgtaaaagctggtgataca
ttgcgaaagattagcacaaaatatcatacttcttggaaacacatagctaaactaaataac
ataaaaaatccttatatcatttttccaggacaaatacttaaattacaagaaaatatatct
cagcctgaaccaagcttaaaaaaaacatctgttactcaaaaagatttaaatgaagaatta
gttatggcagaactttggatgcaaacttctgctgaatacagaggtctttgctatcaagct
tataataacgctagatctattataaaagataaagtatcaacctttaaaaaaggagacaaa
cctttagccataatcactgattgcgatgaaactgttattgaaaatagtatttatgatgct
ggttttataggtcataatgattctcataatccagataattggcctaaatgggttaatgca
tccgctggcaatgcaatgcctggtgcaaaacaatttttagattatgctaatagtaaaggt
gttgaaattttttatgtaacgggaagagatgagaaaaatagtttagatggaactatgaaa
aatctaaagaaactaaattttccttgcgtagataaataccatatgcgtttaaaaaccgat
acaggtaataaagagcctagaatgaaagaaattgaaaaaaaatataatgtaataatttat
atgggtgatgatgcaggtgattttccaataggttcttatcacaaagacgtaaatgctaga
aattctttattagataaaaatagtgataaatttggtacaaagtttataattttgcctaat
ccaagctatggtcactgggaatcctctcttcacaaaaattattggcaattaactcctgaa
caaaaggattccttaagaaagaaatttataaaaacttggagatgtgataataaataa

DBGET integrated database retrieval system